IKMC Project Report - KOMP-CSD (ID: 34159)

Slc7a13 MGI:1921337 ENSMUSG00000041052 OTTMUSG00000006379
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035890 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAMDSKKEIRLKRELGYFWGTNFLIINIIGAGIFVSPKGVLQHSSMNVGVSLCVWAVCAVLTLTSALCSAEIGITFPYSG
AHYYFLKRCFGPLVAFLRLWTSLFLGPGLIASQALLLAEYGVQPFYPSCSAPILPRKCLALAMLWIVGILNSRGVKELSW
LQTVSSVLKVGILGVISLSGLFLLVRGKKENVQRLQNAFDAEFPEVSQLIEAIFQGYFAFSGGGCFTCIAGELKKPSKTI
PRCIFTGLPLVTVVYLLANISYLTVLTPQEMLSS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000356413 AA-permease_dom (207/420 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000250026 AA-permease_dom (45/420 aa) CDS CDS + stop codon + UTR
ENSMUSE00000250020 AA-permease_dom (121/420 aa) CDS Deleted
ENSMUSE00000367136 AA-permease_dom (49/420 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 212860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00153_Z_4_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 212860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00153_B_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 212860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00153_Y_4_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 212860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00153_Y_1_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 212860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00153_A_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
212860 Knockout-First - Reporter Tagged Insertion PCS00153_A_C03