IKMC Project Report - EUCOMM (ID: 34234)

1110051M20Rik MGI:1915079 ENSMUSG00000040591 OTTMUSG00000014431
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000102594 protein_coding No protein product (NMD) view

Predicted translation:

MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTDYFNSVCQGTHILFREFSFIQATPHNRASFLR
AFWRCFRTVGKNGGLCSWMMPWTA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000808761 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001048071 CDS CDS
ENSMUSE00001074501 CDS CDS
ENSMUSE00001008888 CDS Deleted
ENSMUSE00000450424 CDS CDS + stop codon + UTR
ENSMUSE00000302903 CDS
ENSMUSE00000302896 CDS
ENSMUSE00000302888 CDS
ENSMUSE00000764645 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000064652 protein_coding No protein product (NMD) view

Predicted translation:

MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTDYFNSVCQGTHILFREFSFIQATPHNRASFLR
AFWRCFRTVGKNGGLCSWMMPWTA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000737036 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001048071 CDS CDS
ENSMUSE00001074501 CDS CDS
ENSMUSE00001008888 CDS Deleted
ENSMUSE00000450424 CDS CDS + stop codon + UTR
ENSMUSE00000302903 CDS
ENSMUSE00000302896 CDS
ENSMUSE00000302888 CDS
ENSMUSE00000687519 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000094835 protein_coding Residual C-terminal product view

Predicted translation:

MDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFYQR
LENLCDRHKYSCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALGALPDKGDLMHDPAMDEELERLLVQVPGLVNSI
TATSEASCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000600112 UTR UTR
ENSMUSE00001079522 UTR UTR
ENSMUSE00001091945 UTR + start codon + CDS Deleted
ENSMUSE00000450424 CDS UTR + start codon + CDS
ENSMUSE00000302903 CDS CDS
ENSMUSE00000302896 CDS CDS
ENSMUSE00000302888 CDS CDS
ENSMUSE00000600111 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132092 processed_transcript Target region does not overlap transcript
ENSMUST00000145573 processed_transcript No analysis available: incomplete transcript
ENSMUST00000141262 processed_transcript Target region does not overlap transcript
ENSMUST00000139807 processed_transcript Target region does not overlap transcript
ENSMUST00000139490 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available