IKMC Project Report - KOMP-CSD (ID: 34264)

Aadacl3 MGI:2685281 ENSMUSG00000078507 OTTMUSG00000010538
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000105749 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MVVLALTLLVGSVAVFSLGSLLWVVGKHFWTEHIPEGITHPWRLRILSCLFHLTMTWIQEISHVQVPSDER*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000667406 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000667405 AB_hydrolase_3 (14/126 aa) CDS Deleted
ENSMUSE00000667404 AB_hydrolase_3 (22/126 aa) CDS Deleted
ENSMUSE00000667403 AB_hydrolase_3 (92/126 aa) | AB_hydrolase_3 (63/63 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 43712 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00045_D_C11 L1L2_gt1 L3L4_pZero_DTA_kan view
order 43712 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00045_A_C11 L1L2_gt1 L3L4_pZero_DTA_kan view
order 43712 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00045_B_4_C11 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
43712 Knockout First, Reporter-tagged insertion with conditional potential PCS00045_A_C11