IKMC Project Report - EUCOMM (ID: 34305)

1200011I18Rik MGI:1914717 ENSMUSG00000022008
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022585 protein_coding No protein product (NMD) view

Predicted translation:

MARDLIGPALPPGFKEHATVEDEERDPSPVAGPALPPNYRSCSSDSSDSDEDSSSLSEEGNQESEEEDTGPNAKKQRRNQ
DDDDDDDGFFGPALPPGFKKQDDSPPRKQRAVKMRILLDQCLQKDQLTIASRQSLKKGPRG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000275483 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000275475 CDS CDS
ENSMUSE00000122885 CDS CDS
ENSMUSE00000122882 CDS Deleted
ENSMUSE00000122881 CDS CDS + stop codon + UTR
ENSMUSE00000122880 DUF3752 (39/138 aa) CDS
ENSMUSE00000122884 DUF3752 (33/138 aa) CDS
ENSMUSE00000122883 DUF3752 (66/138 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 51814 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03005_Z_2_G01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
51814 Knockout First, Reporter-tagged insertion with conditional potential PCS03005_A_B03