IKMC Project Report - KOMP-CSD (ID: 34722)

Alox8 MGI:1098228 ENSMUSG00000020891 OTTMUSG00000005969
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021262 protein_coding No protein product (NMD) view

Predicted translation:

MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQDVGTVLMLRVHKAPPEVSLPL
MSFRSDAWFCRWFELEWLPGAALHFPCYQWLEGAGELVLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWP
RCLDHETVKDLDLNIKYSAMKNAKLFFKAHSAVCVCTLAGRCLLRLPVPKWHQPGPDSPLSQSPKQLPGH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000914201 LipOase_LH2 (46/118 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000111910 LipOase_LH2 (72/118 aa) CDS CDS
ENSMUSE00000974602 CDS CDS
ENSMUSE00001014903 CDS CDS
ENSMUSE00000111904 LipOase_C (11/453 aa) CDS Deleted
ENSMUSE00000250287 LipOase_C (58/453 aa) CDS CDS + stop codon + UTR
ENSMUSE00000250282 LipOase_C (49/453 aa) CDS
ENSMUSE00000111915 LipOase_C (68/453 aa) CDS
ENSMUSE00000111901 LipOase_C (29/453 aa) CDS
ENSMUSE00000111913 LipOase_C (57/453 aa) CDS
ENSMUSE00000111907 LipOase_C (42/453 aa) CDS
ENSMUSE00000111902 LipOase_C (34/453 aa) CDS
ENSMUSE00000111900 LipOase_C (57/453 aa) CDS
ENSMUSE00000111911 LipOase_C (51/453 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000094078 protein_coding No protein product (NMD) view

Predicted translation:

MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQDVGTVLMLRVHKAPPEVSLPL
MSFRSDAWFCRWFELEWLPGAALHFPCYQWLEGAGELVLREGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWP
RCLDHETVKDLDLNIKYSAMKNAKLFFKAHSAVCVCTLAGRCLLRLPVPKWHQPGPDSPLSQSPKQLPGH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000824194 LipOase_LH2 (46/118 aa) CDS CDS
ENSMUSE00000111910 LipOase_LH2 (72/118 aa) CDS CDS
ENSMUSE00000974602 CDS CDS
ENSMUSE00001014903 CDS CDS
ENSMUSE00000111904 LipOase_C (11/186 aa) CDS Deleted
ENSMUSE00000250287 LipOase_C (58/186 aa) CDS CDS + stop codon + UTR
ENSMUSE00000250282 LipOase_C (49/186 aa) CDS
ENSMUSE00000111915 LipOase_C (68/186 aa) CDS
ENSMUSE00000111913 LipOase_C (1/186 aa) | LipOase_C (47/229 aa) CDS
ENSMUSE00000111907 LipOase_C (42/229 aa) CDS
ENSMUSE00000111902 LipOase_C (34/229 aa) CDS
ENSMUSE00000111900 LipOase_C (57/229 aa) CDS
ENSMUSE00000727061 LipOase_C (51/229 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000144787 retained_intron No analysis available: incomplete transcript
ENSMUST00000156157 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 37997 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) GR00032_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
37997 Knockout First, Reporter-tagged insertion with conditional potential PCS00027_A_F08