IKMC Project Report - KOMP-CSD (ID: 34811)

Wnt5b MGI:98959 ENSMUSG00000030170 OTTMUSG00000027047
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000119369 protein_coding No protein product (NMD) view

Predicted translation:

MLVPGHWDGLRPAMPSLLLVVVAALLSSWAQLLTDANSWW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000719380 UTR UTR
ENSMUSE00001072154 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001078608 Wnt (63/313 aa) CDS Deleted
ENSMUSE00000196034 Wnt (98/313 aa) CDS CDS + stop codon + UTR
ENSMUSE00000373284 Wnt (152/313 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000178696 protein_coding Residual C-terminal product view

Predicted translation:

MNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPE
DLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQY
VCK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000969806 UTR UTR
ENSMUSE00001072154 UTR + start codon + CDS
ENSMUSE00001078608 Wnt (63/313 aa) CDS Deleted
ENSMUSE00000196034 Wnt (98/313 aa) CDS UTR + start codon + CDS
ENSMUSE00000719102 Wnt (152/313 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000117171 protein_coding Residual C-terminal product view

Predicted translation:

MNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPE
DLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQY
VCK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000719939 UTR UTR
ENSMUSE00001072154 UTR + start codon + CDS
ENSMUSE00001078608 Wnt (63/313 aa) CDS Deleted
ENSMUSE00000196034 Wnt (98/313 aa) CDS UTR + start codon + CDS
ENSMUSE00000719102 Wnt (152/313 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118120 protein_coding Residual C-terminal product view

Predicted translation:

MNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPE
DLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQY
VCK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693030 UTR UTR
ENSMUSE00001004967 UTR UTR
ENSMUSE00001079706 Wnt (63/313 aa) UTR + start codon + CDS Deleted
ENSMUSE00000196034 Wnt (98/313 aa) CDS UTR + start codon + CDS
ENSMUSE00000712340 Wnt (152/313 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45263 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00058_A_C11 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45263 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00058_Z_4_C11 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45263 Knockout-First - Reporter Tagged Insertion PCS00058_A_C11