IKMC Project Report - EUCOMM (ID: 34905)

Lao1 MGI:2140628 ENSMUSG00000024903 OTTMUSG00000008819
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000058651 protein_coding No protein product (NMD) view

Predicted translation:

MSFRTMAKKSGILVWGILLCVSSCLALYENLVKCFQDPDYEAFLLIAQNGLHTSPLSKRVVVVGAGMAGLVAAKTLQDAG
HEVTILEASNHIGGRVVTLRNKEEGWYLELGPMRIPESHKSNHIGRHPTAASCSPFMTLTPPRLT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000246658 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000246648 Amino_oxidase (15/442 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (23/44 aa) | FAD_bind2_N (22/35 aa) | Pyr_OxRdtase_NAD-bd_dom (23/35 aa) | CHP00275_HI0933-like (23/38 aa) | (24/37 aa) | mOase_FAD-bd (23/31 aa) CDS CDS
ENSMUSE00000246637 Amino_oxidase (38/442 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (21/44 aa) | FAD_bind2_N (13/35 aa) | Pyr_OxRdtase_NAD-bd_dom (12/35 aa) | CHP00275_HI0933-like (15/38 aa) | (13/37 aa) | mOase_FAD-bd (8/31 aa) CDS CDS
ENSMUSE00000246626 Amino_oxidase (68/442 aa) CDS Deleted
ENSMUSE00000146026 Amino_oxidase (23/442 aa) CDS CDS
ENSMUSE00000246606 Amino_oxidase (46/442 aa) CDS CDS + stop codon + UTR
ENSMUSE00000513192 Amino_oxidase (254/442 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000142457 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available