IKMC Project Report - EUCOMM (ID: 34999)

Wars MGI:104630 ENSMUSG00000021266 OTTMUSG00000034952
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000161154 protein_coding No protein product (NMD) view

Predicted translation: 

MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKFSLEAAKLTKS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000855874 UTR UTR
ENSMUSE00000116158 WHEP-TRS (21/56 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061680 WHEP-TRS (35/56 aa) CDS Deleted
ENSMUSE00000998815 CDS CDS + stop codon + UTR
ENSMUSE00001062229 aa-tRNA-synth_Ic (29/288 aa) CDS
ENSMUSE00001043583 aa-tRNA-synth_Ic (62/288 aa) CDS
ENSMUSE00001085018 aa-tRNA-synth_Ic (35/288 aa) CDS
ENSMUSE00000980513 aa-tRNA-synth_Ic (96/288 aa) CDS
ENSMUSE00001074726 aa-tRNA-synth_Ic (47/288 aa) CDS
ENSMUSE00000392283 aa-tRNA-synth_Ic (22/288 aa) CDS
ENSMUSE00000848321 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109848 protein_coding No protein product (NMD) view

Predicted translation: 

MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKFSLEAAKLTKS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000857186 UTR UTR
ENSMUSE00000116158 WHEP-TRS (21/56 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061680 WHEP-TRS (35/56 aa) CDS Deleted
ENSMUSE00000998815 CDS CDS + stop codon + UTR
ENSMUSE00001062229 aa-tRNA-synth_Ic (29/288 aa) CDS
ENSMUSE00001043583 aa-tRNA-synth_Ic (62/288 aa) CDS
ENSMUSE00001085018 aa-tRNA-synth_Ic (35/288 aa) CDS
ENSMUSE00000980513 aa-tRNA-synth_Ic (96/288 aa) CDS
ENSMUSE00001074726 aa-tRNA-synth_Ic (47/288 aa) CDS
ENSMUSE00000977571 aa-tRNA-synth_Ic (22/288 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000161410 protein_coding No protein product (NMD) view

Predicted translation: 

MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKFSLEAAKLTKS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000861312 UTR UTR
ENSMUSE00000116158 WHEP-TRS (21/56 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061680 WHEP-TRS (35/56 aa) CDS Deleted
ENSMUSE00000998815 CDS CDS + stop codon + UTR
ENSMUSE00001062229 aa-tRNA-synth_Ic (29/288 aa) CDS
ENSMUSE00001043583 aa-tRNA-synth_Ic (62/288 aa) CDS
ENSMUSE00001085018 aa-tRNA-synth_Ic (35/288 aa) CDS
ENSMUSE00000980513 aa-tRNA-synth_Ic (96/288 aa) CDS
ENSMUSE00001074726 aa-tRNA-synth_Ic (47/288 aa) CDS
ENSMUSE00000977571 aa-tRNA-synth_Ic (22/288 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162748 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000160477 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKDC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000440358 UTR UTR
ENSMUSE00000116158 WHEP-TRS (21/23 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000863591 WHEP-TRS (2/23 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001085300 UTR Deleted
ENSMUSE00001025208 UTR UTR
ENSMUSE00001002796 UTR UTR
ENSMUSE00001078367 UTR UTR
ENSMUSE00001071469 UTR UTR
ENSMUSE00001028477 UTR UTR
ENSMUSE00000973046 UTR UTR
ENSMUSE00000983731 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000162952 retained_intron Target region does not overlap transcript
ENSMUST00000160974 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0563_6_C05 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_G08 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_G06 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_B05 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_B06 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_B07 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_C08 PRPGS00099_A_C10 Warstm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0563_6_D08 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_A07 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_E05 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_F07 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_G07 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_H06 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_H07 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0563_6_B08 PRPGS00099_A_C10 Warstm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_3_D10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_4_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_2_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_1_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_4_D10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_3_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_1_D10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PPGT0099_Z_2_D10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 82100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00099_A_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
82100 Knockout First, Reporter-tagged insertion with conditional potential PCTS00099_A_C10