IKMC Project Report - KOMP-CSD (ID: 35593)

Grin2b MGI:95821 ENSMUSG00000030209 OTTMUSG00000016356
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000111905 protein_coding No protein product (NMD) view

Predicted translation:

MKPSAECCSPKFWLVLAVLAVSGSKARSQKSAPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKS
IITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKVSDQRHF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000689710 UTR UTR
ENSMUSE00000689708 UTR UTR
ENSMUSE00000689706 UTR UTR
ENSMUSE00001022187 ANF_lig-bd_rcpt (9/149 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001068896 ANF_lig-bd_rcpt (140/149 aa) CDS Deleted
ENSMUSE00000314423 CDS CDS + stop codon + UTR
ENSMUSE00000196386 CDS
ENSMUSE00000196395 SBP_bac_3 (42/341 aa) | Glu_rcpt_Glu/Gly-bd (52/55 aa) CDS
ENSMUSE00000547656 SBP_bac_3 (52/341 aa) | Glu_rcpt_Glu/Gly-bd (3/55 aa) CDS
ENSMUSE00000196389 Iontro_glu_rcpt (38/274 aa) | SBP_bac_3 (43/341 aa) CDS
ENSMUSE00000196391 Iontro_glu_rcpt (77/274 aa) | SBP_bac_3 (77/341 aa) CDS
ENSMUSE00000196397 Iontro_glu_rcpt (54/274 aa) | SBP_bac_3 (54/341 aa) CDS
ENSMUSE00000547647 Iontro_glu_rcpt (64/274 aa) | SBP_bac_3 (64/341 aa) CDS
ENSMUSE00000196388 NMDAR2_C (26/643 aa) | Iontro_glu_rcpt (44/274 aa) | SBP_bac_3 (13/341 aa) CDS
ENSMUSE00000689674 NMDAR2_C (616/643 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000053880 protein_coding No analysis available: incomplete transcript
ENSMUST00000152012 processed_transcript No analysis available: incomplete transcript
ENSMUST00000143943 processed_transcript Target region does not overlap transcript
ENSMUST00000125905 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 37380 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00021_A_C09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37380 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00021_A_2_C09 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
37380 Knockout First, Reporter-tagged insertion with conditional potential PCS00021_A_C09