IKMC Project Report - EUCOMM (ID: 35799)

2810021J22Rik MGI:1917194 ENSMUSG00000020491 OTTMUSG00000005769
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000073924 protein_coding Novel C-terminal product view

Predicted translation: 

MEGRQCPRPEPPSSAAYEESEGSQKGHWEETFEPPASHWQCIS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000678146 UTR UTR
ENSMUSE00000364496 UTR + start codon + CDS
ENSMUSE00001088004 Krueppel-associated_box (40/40 aa) CDS Deleted
ENSMUSE00000974857 Krueppel-associated_box (1/40 aa) CDS UTR + start codon + CDS
ENSMUSE00000746865 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132570 protein_coding No protein product view

Predicted translation: 

MSSIVVQDKPARFQSF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000827911 UTR UTR
ENSMUSE00000364496 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001088004 Krueppel-associated_box (40/40 aa) CDS Deleted
ENSMUSE00000722979 Krueppel-associated_box (1/40 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 285 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_4_H05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 285 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_2_H05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 285 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00004_A_H05 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
285 Knockout First, Reporter-tagged insertion with conditional potential PCS00004_A_H05