IKMC Project Report - KOMP-CSD (ID: 35844)

Fh1 MGI:95530 ENSMUSG00000026526 OTTMUSG00000025588
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027810 protein_coding No protein product (NMD) view

Predicted translation: 

MYRALRLLARSRRLLRVPSAGAAVSGEATTLPRCAPNVARMASQNSFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGG
ATERMPIPVIQAFGILKRAAAEVNQEYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIE
MLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHKVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLT
LGQVCLLSLPRISLKLWLLMMLWLSLVEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000845394 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000160218 Lyase1_N (31/332 aa) CDS CDS
ENSMUSE00001066885 Lyase1_N (37/332 aa) CDS CDS
ENSMUSE00000160214 Lyase1_N (59/332 aa) CDS CDS
ENSMUSE00000160216 Lyase1_N (61/332 aa) CDS CDS
ENSMUSE00000160217 Lyase1_N (56/332 aa) CDS Deleted
ENSMUSE00000160223 Lyase1_N (69/332 aa) CDS CDS + stop codon + UTR
ENSMUSE00000160224 Lyase1_N (21/332 aa) CDS
ENSMUSE00000998607 Fumarase_C_C (9/55 aa) CDS
ENSMUSE00000749864 Fumarase_C_C (47/55 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176740 protein_coding No analysis available: incomplete transcript
ENSMUST00000154956 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000133218 retained_intron Target region does not overlap transcript
ENSMUST00000130996 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0881_4_E07 PG00075_Z_2_A03 Fh1tm2a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0134_2_C03 PRPGS00075_A_A03 Fh1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0134_2_F04 PRPGS00075_A_A03 Fh1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 50860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00075_Z_2_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 50860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00075_B_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 50860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00075_Z_3_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 50860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00075_V_1_C07 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 50860 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00075_A_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
50860 Knockout-First - Reporter Tagged Insertion PCS00075_A_A03
50860 Knockout-First - Reporter Tagged Insertion PCS00075_B_A03