IKMC Project Report - EUCOMM (ID: 35859)

B9d1 MGI:1351471 ENSMUSG00000001039 OTTMUSG00000005834
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000102657 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAAASPSVFLLMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGHRLYSVSMGRMCLGMMSSEAMEQCMCPSLQDGTKG
PSPCLCQSLHLHYRSSQAGSWDGDPSTQTPRWWPRVKAGK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662206 B9_dom (10/164 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000976560 B9_dom (23/164 aa) CDS CDS
ENSMUSE00001082608 B9_dom (38/164 aa) CDS Deleted
ENSMUSE00001018928 B9_dom (33/164 aa) CDS CDS
ENSMUSE00000975484 B9_dom (22/164 aa) CDS CDS
ENSMUSE00001089429 B9_dom (24/164 aa) CDS CDS
ENSMUSE00001083324 B9_dom (18/164 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000127889 protein_coding Target region does not overlap transcript
ENSMUST00000138057 processed_transcript No analysis available: incomplete transcript
ENSMUST00000140548 processed_transcript No analysis available: incomplete transcript
ENSMUST00000155176 processed_transcript No analysis available: incomplete transcript
ENSMUST00000146562 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 296 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_1_H10 L1L2_gt0 L3L4_pZero_DTA_kan view
order 296 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_4_H10 L1L2_gt0 L3L4_pZero_DTA_kan view
order 296 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_2_H10 L1L2_gt0 L3L4_pZero_DTA_kan view
order 296 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00004_A_3_H10 L1L2_gt0 L3L4_pZero_DTA_kan view
order 296 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00004_A_H10 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
296 Knockout First, Reporter-tagged insertion with conditional potential PCS00004_A_H10