IKMC Project Report - EUCOMM (ID: 36045)

R3hdml MGI:3650937 ENSMUSG00000078949 OTTMUSG00000001070
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000109416 protein_coding No protein product (NMD) view

Predicted translation: 

MPLLSSIVGLTGLLLWMGHTVGALRMPNTTLVQGRPKNTAVWPLSGLGVPRHRRKRHISARDMSALLDYHNHIRASVHPP
AANMEYMVPFCGRPCEVLV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000680204 CAP_domain (20/141 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000680203 CAP_domain (40/141 aa) CDS Deleted
ENSMUSE00000680202 CAP_domain (45/141 aa) CDS CDS + stop codon + UTR
ENSMUSE00000680200 CAP_domain (37/141 aa) CDS
ENSMUSE00000680199 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 77481 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00084_Z_2_E11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 77481 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00084_Z_1_E11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 77481 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00084_Z_3_E11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 77481 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00084_A_E11 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
77481 Knockout-First - Reporter Tagged Insertion PCS00084_A_E11