IKMC Project Report - EUCOMM (ID: 36045)
R3hdml MGI:3650937 ENSMUSG00000078949 OTTMUSG00000001070
Mice no data available
Mutagenesis Predictions
This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000109416 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||
|
Predicted translation: MPLLSSIVGLTGLLLWMGHTVGALRMPNTTLVQGRPKNTAVWPLSGLGVPRHRRKRHISARDMSALLDYHNHIRASVHPP AANMEYMVPFCGRPCEVLV*
|
||||||||||||||||||||||||||||||||||
ES Cell Clones no data available
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 77481 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00084_Z_2_E11 | L1L2_Bact_P | L3L4_pD223_DTA_spec | view |
| order | 77481 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00084_Z_1_E11 | L1L2_Bact_P | L3L4_pD223_DTA_spec | view |
| order | 77481 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00084_Z_3_E11 | L1L2_Bact_P | L3L4_pD223_DTA_spec | view |
| order | 77481 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PRPGS00084_A_E11 | L1L2_Bact_P | L3L4_pD223_DTA_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 77481 | Knockout-First - Reporter Tagged Insertion | PCS00084_A_E11 |