IKMC Project Report - EUCOMM (ID: 36149)

2310045N01Rik MGI:1919618 ENSMUSG00000002345 OTTMUSG00000022206
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000002418 protein_coding No protein product (NMD) view

Predicted translation: 

MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKCCEELGGQQRVLP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000744938 UPF0402_NEP (12/118 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/118 aa) CDS CDS
ENSMUSE00001072941 UPF0402_NEP (22/118 aa) CDS Deleted
ENSMUSE00000984239 UPF0402_NEP (38/118 aa) CDS CDS + stop codon + UTR
ENSMUSE00001000820 UPF0402_NEP (11/118 aa) CDS + stop codon + UTR
ENSMUSE00000213943 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000072500 protein_coding Target region does not overlap transcript
ENSMUST00000163756 protein_coding Design floxes no exons in transcript ENSMUST00000163756
ENSMUST00000164040 protein_coding Target region does not overlap transcript
ENSMUST00000110139 protein_coding No protein product (NMD) view

Predicted translation: 

MGALRVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKCCEELGGQQRVLP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682907 UPF0402_NEP (2/108 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/108 aa) CDS CDS
ENSMUSE00001072941 UPF0402_NEP (22/108 aa) CDS Deleted
ENSMUSE00000984239 UPF0402_NEP (38/108 aa) CDS CDS + stop codon + UTR
ENSMUSE00001000820 UPF0402_NEP (11/108 aa) CDS + stop codon + UTR
ENSMUSE00000682906 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000123760 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation: 

MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKSPHGGRRALTPVGVL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000726363 UPF0402_NEP (12/73 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042887 UPF0402_NEP (38/73 aa) CDS CDS
ENSMUSE00001072941 UPF0402_NEP (22/73 aa) CDS Deleted
ENSMUSE00001070815 UPF0402_NEP (3/73 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000768356 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000123976 retained_intron No analysis available: incomplete transcript
ENSMUST00000129668 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0144_5_A02 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test pass Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_F01 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_B02 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_B02 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA fail LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_D03 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_E01 PRPGS00071_A_E03 2310045N01Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0144_5_C02 PRPGS00071_A_E03 2310045N01Riktm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_5_F04 PRPGS00071_A_E03 2310045N01Riktm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_7_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_5_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_2_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_6_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_4_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_3_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_1_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47644 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00071_A_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47644 Knockout First, Reporter-tagged insertion with conditional potential PCS00071_A_E03