IKMC Project Report - EUCOMM (ID: 36315)

Tmem214 MGI:1916046 ENSMUSG00000038828 OTTMUSG00000022318
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000046349 protein_coding No protein product (NMD) view

Predicted translation: 

MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVLKYDLSSGCGSSAEGTGQEPERVHWEPLRVAEGPGQ
LSQLQAPDSTDGAHSEPVST*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000792174 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000996241 CDS Deleted
ENSMUSE00001015457 CDS CDS
ENSMUSE00001017866 CDS CDS + stop codon + UTR
ENSMUSE00001081859 DUF2359_TMEM214 (23/467 aa) CDS
ENSMUSE00001064789 DUF2359_TMEM214 (36/467 aa) CDS
ENSMUSE00001043255 DUF2359_TMEM214 (28/467 aa) CDS
ENSMUSE00001073431 DUF2359_TMEM214 (35/467 aa) CDS
ENSMUSE00000980333 DUF2359_TMEM214 (48/467 aa) CDS
ENSMUSE00001019540 DUF2359_TMEM214 (31/467 aa) CDS
ENSMUSE00001059580 DUF2359_TMEM214 (17/467 aa) CDS
ENSMUSE00000987414 DUF2359_TMEM214 (38/467 aa) CDS
ENSMUSE00001009154 DUF2359_TMEM214 (40/467 aa) CDS
ENSMUSE00000970468 DUF2359_TMEM214 (33/467 aa) CDS
ENSMUSE00001045890 DUF2359_TMEM214 (57/467 aa) CDS
ENSMUSE00001071876 DUF2359_TMEM214 (49/467 aa) CDS
ENSMUSE00000819281 DUF2359_TMEM214 (39/467 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114716 protein_coding No protein product (NMD) view

Predicted translation: 

MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVLKYDLSSGCGSSAEGTGQEPERVHWEPLRVAEGPGQ
LSQLQAPDSTDGAHSEPVSTWGVATWVPHLYSSRSARQA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000358018 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000996241 CDS Deleted
ENSMUSE00001015457 CDS CDS
ENSMUSE00001081859 DUF2359_TMEM214 (23/467 aa) CDS CDS + stop codon + UTR
ENSMUSE00001064789 DUF2359_TMEM214 (36/467 aa) CDS
ENSMUSE00001043255 DUF2359_TMEM214 (28/467 aa) CDS
ENSMUSE00001073431 DUF2359_TMEM214 (35/467 aa) CDS
ENSMUSE00000980333 DUF2359_TMEM214 (48/467 aa) CDS
ENSMUSE00001019540 DUF2359_TMEM214 (31/467 aa) CDS
ENSMUSE00001059580 DUF2359_TMEM214 (17/467 aa) CDS
ENSMUSE00000987414 DUF2359_TMEM214 (38/467 aa) CDS
ENSMUSE00001009154 DUF2359_TMEM214 (40/467 aa) CDS
ENSMUSE00000970468 DUF2359_TMEM214 (33/467 aa) CDS
ENSMUSE00001045890 DUF2359_TMEM214 (57/467 aa) CDS
ENSMUSE00001071876 DUF2359_TMEM214 (49/467 aa) CDS
ENSMUSE00000700343 DUF2359_TMEM214 (39/467 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149013 retained_intron No analysis available: incomplete transcript
ENSMUST00000150310 retained_intron No analysis available: incomplete transcript
ENSMUST00000132288 retained_intron Target region does not overlap transcript
ENSMUST00000146662 processed_transcript Target region does not overlap transcript
ENSMUST00000147406 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0142_5_B02 PRPGS00069_A_E06 Tmem214tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0142_5_A03 PRPGS00069_A_E06 Tmem214tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_2_E07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_3_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_1_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_4_E07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_5_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_8_E07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00069_A_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_7_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_4_E08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_6_E07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48481 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00069_Z_6_E06 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
48481 Knockout First, Reporter-tagged insertion with conditional potential PCS00069_A_E06