IKMC Project Report - KOMP-CSD (ID: 36407)

Stat3 MGI:103038 ENSMUSG00000004040 OTTMUSG00000002128
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 14 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000127638 protein_coding No protein product (NMD) view

Predicted translation: 

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQ
HNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQDNFISRISTSDPPTN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000790058 UTR UTR
ENSMUSE00000245200 STAT_TF_prot_interaction (41/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000112858 STAT_TF_prot_interaction (49/120 aa) CDS CDS
ENSMUSE00000112839 STAT_TF_prot_interaction (31/120 aa) CDS CDS
ENSMUSE00001080176 STAT_TF_alpha (17/181 aa) CDS Deleted
ENSMUSE00000661304 STAT_TF_alpha (28/181 aa) CDS Deleted
ENSMUSE00000661303 STAT_TF_alpha (32/181 aa) CDS Deleted
ENSMUSE00001092073 STAT_TF_alpha (51/181 aa) CDS Deleted
ENSMUSE00001088309 STAT_TF_alpha (54/181 aa) CDS CDS + stop codon + UTR
ENSMUSE00001074760 STAT_TF_DNA-bd (29/254 aa) | STAT_TF_alpha (2/181 aa) CDS
ENSMUSE00001039661 STAT_TF_DNA-bd (21/254 aa) CDS
ENSMUSE00001080211 STAT_TF_DNA-bd (11/254 aa) CDS
ENSMUSE00000991965 STAT_TF_DNA-bd (32/254 aa) CDS
ENSMUSE00001017972 STAT_TF_DNA-bd (16/254 aa) CDS
ENSMUSE00001065185 STAT_TF_DNA-bd (28/254 aa) CDS
ENSMUSE00001021366 STAT_TF_DNA-bd (33/254 aa) CDS
ENSMUSE00001036055 STAT_TF_DNA-bd (46/254 aa) CDS
ENSMUSE00000986460 STAT_TF_DNA-bd (18/254 aa) CDS
ENSMUSE00001016830 STAT_TF_DNA-bd (24/254 aa) CDS
ENSMUSE00000112841 SH2 (46/91 aa) CDS
ENSMUSE00000112845 SH2 (46/91 aa) CDS
ENSMUSE00000997899 CDS
ENSMUSE00001019759 CDS
ENSMUSE00000833933 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000092671 protein_coding No protein product (NMD) view

Predicted translation: 

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQ
HNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQDNFISRISTSDPPTN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000776379 UTR UTR
ENSMUSE00000245200 STAT_TF_prot_interaction (41/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000112858 STAT_TF_prot_interaction (49/120 aa) CDS CDS
ENSMUSE00000112839 STAT_TF_prot_interaction (31/120 aa) CDS CDS
ENSMUSE00001080176 STAT_TF_alpha (17/181 aa) CDS Deleted
ENSMUSE00000661304 STAT_TF_alpha (28/181 aa) CDS Deleted
ENSMUSE00000661303 STAT_TF_alpha (32/181 aa) CDS Deleted
ENSMUSE00001092073 STAT_TF_alpha (51/181 aa) CDS Deleted
ENSMUSE00001088309 STAT_TF_alpha (54/181 aa) CDS CDS + stop codon + UTR
ENSMUSE00001074760 STAT_TF_DNA-bd (29/254 aa) | STAT_TF_alpha (2/181 aa) CDS
ENSMUSE00001039661 STAT_TF_DNA-bd (21/254 aa) CDS
ENSMUSE00001080211 STAT_TF_DNA-bd (11/254 aa) CDS
ENSMUSE00000991965 STAT_TF_DNA-bd (32/254 aa) CDS
ENSMUSE00001017972 STAT_TF_DNA-bd (16/254 aa) CDS
ENSMUSE00001065185 STAT_TF_DNA-bd (28/254 aa) CDS
ENSMUSE00001021366 STAT_TF_DNA-bd (33/254 aa) CDS
ENSMUSE00001036055 STAT_TF_DNA-bd (46/254 aa) CDS
ENSMUSE00000986460 STAT_TF_DNA-bd (18/254 aa) CDS
ENSMUSE00001016830 STAT_TF_DNA-bd (24/254 aa) CDS
ENSMUSE00000112841 SH2 (46/91 aa) CDS
ENSMUSE00000835564 SH2 (46/91 aa) CDS
ENSMUSE00000997899 CDS
ENSMUSE00001019759 CDS
ENSMUSE00000577144 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000103114 protein_coding No protein product (NMD) view

Predicted translation: 

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQ
HNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQDNFISRISTSDPPTN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661306 UTR UTR
ENSMUSE00000245200 STAT_TF_prot_interaction (41/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000112858 STAT_TF_prot_interaction (49/120 aa) CDS CDS
ENSMUSE00000112839 STAT_TF_prot_interaction (31/120 aa) CDS CDS
ENSMUSE00001080176 STAT_TF_alpha (17/181 aa) CDS Deleted
ENSMUSE00000661304 STAT_TF_alpha (28/181 aa) CDS Deleted
ENSMUSE00000661303 STAT_TF_alpha (32/181 aa) CDS Deleted
ENSMUSE00001092073 STAT_TF_alpha (51/181 aa) CDS Deleted
ENSMUSE00001088309 STAT_TF_alpha (54/181 aa) CDS CDS + stop codon + UTR
ENSMUSE00001074760 STAT_TF_DNA-bd (29/254 aa) | STAT_TF_alpha (2/181 aa) CDS
ENSMUSE00001039661 STAT_TF_DNA-bd (21/254 aa) CDS
ENSMUSE00001080211 STAT_TF_DNA-bd (11/254 aa) CDS
ENSMUSE00000991965 STAT_TF_DNA-bd (32/254 aa) CDS
ENSMUSE00001017972 STAT_TF_DNA-bd (16/254 aa) CDS
ENSMUSE00001065185 STAT_TF_DNA-bd (28/254 aa) CDS
ENSMUSE00001021366 STAT_TF_DNA-bd (33/254 aa) CDS
ENSMUSE00001036055 STAT_TF_DNA-bd (46/254 aa) CDS
ENSMUSE00000986460 STAT_TF_DNA-bd (18/254 aa) CDS
ENSMUSE00001016830 STAT_TF_DNA-bd (24/254 aa) CDS
ENSMUSE00000112841 SH2 (46/91 aa) CDS
ENSMUSE00000112845 SH2 (46/91 aa) CDS
ENSMUSE00000997899 CDS
ENSMUSE00000661302 CDS + stop codon + UTR
ENSMUSE00000661301 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000138438 protein_coding No protein product (NMD) view

Predicted translation: 

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQ
HNLRRIKQFLQTAATAAQDNFISRISTSDPPTN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000818868 UTR UTR
ENSMUSE00000245200 STAT_TF_prot_interaction (41/91 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000112858 STAT_TF_prot_interaction (49/91 aa) CDS CDS
ENSMUSE00000756123 STAT_TF_prot_interaction (2/91 aa) CDS CDS
ENSMUSE00001080176 STAT_TF_alpha (17/181 aa) CDS Deleted
ENSMUSE00000661304 STAT_TF_alpha (28/181 aa) CDS Deleted
ENSMUSE00000661303 STAT_TF_alpha (32/181 aa) CDS Deleted
ENSMUSE00001092073 STAT_TF_alpha (51/181 aa) CDS Deleted
ENSMUSE00001088309 STAT_TF_alpha (54/181 aa) CDS CDS + stop codon + UTR
ENSMUSE00001074760 STAT_TF_DNA-bd (29/254 aa) | STAT_TF_alpha (2/181 aa) CDS
ENSMUSE00001039661 STAT_TF_DNA-bd (21/254 aa) CDS
ENSMUSE00001080211 STAT_TF_DNA-bd (11/254 aa) CDS
ENSMUSE00000991965 STAT_TF_DNA-bd (32/254 aa) CDS
ENSMUSE00001017972 STAT_TF_DNA-bd (16/254 aa) CDS
ENSMUSE00001065185 STAT_TF_DNA-bd (28/254 aa) CDS
ENSMUSE00001021366 STAT_TF_DNA-bd (33/254 aa) CDS
ENSMUSE00001036055 STAT_TF_DNA-bd (46/254 aa) CDS
ENSMUSE00000986460 STAT_TF_DNA-bd (18/254 aa) CDS
ENSMUSE00001016830 STAT_TF_DNA-bd (24/254 aa) CDS
ENSMUSE00000112841 SH2 (46/91 aa) CDS
ENSMUSE00000112845 SH2 (46/91 aa) CDS
ENSMUSE00000997899 CDS
ENSMUSE00001019759 CDS
ENSMUSE00000740031 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000146971 retained_intron Target region does not overlap transcript
ENSMUST00000137093 retained_intron Target region does not overlap transcript
ENSMUST00000152601 retained_intron Target region does not overlap transcript
ENSMUST00000154170 retained_intron No analysis available: incomplete transcript
ENSMUST00000156645 processed_transcript Target region does not overlap transcript
ENSMUST00000137367 retained_intron Target region does not overlap transcript
ENSMUST00000152623 retained_intron No analysis available: incomplete transcript
ENSMUST00000151544 retained_intron Target region does not overlap transcript
ENSMUST00000155972 retained_intron Target region does not overlap transcript
ENSMUST00000130686 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0195_4_C03 PRPGS00097_A_A03 Stat3tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity fail
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0715_1_C09 PG00097_Z_3_A03 Stat3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0715_1_D09 PG00097_Z_3_A03 Stat3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0715_1_G09 PG00097_Z_3_A03 Stat3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0715_1_F09 PG00097_Z_3_A03 Stat3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0195_4_G01 PRPGS00097_A_A03 Stat3tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 94427 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00097_A_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 94427 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00097_Z_3_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
94427 Knockout-First - Reporter Tagged Insertion PCS00097_A_A03