IKMC Project Report - KOMP-CSD (ID: 36497)

Zmynd15 MGI:3603821 ENSMUSG00000040829 OTTMUSG00000006043
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000039093 protein_coding No protein product
ENSMUST00000092958 protein_coding No analysis available: incomplete transcript
ENSMUST00000108563 protein_coding No protein product (NMD) view

Predicted translation: 

MFCEGADPCQAQEGRGREVVAPSVPRRALSGTDRLVGTGEPALRPAPSRGTHTPLPRRRSSSLRPASRRVSQDYPTKPKE
NLGCRTRGIRVSKLWFPKNDSVGFGDFSPLEKSSVCLLVCKVGDPLDPSSGSKMLSLPWTAGSQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000677227 UTR UTR
ENSMUSE00000677224 UTR + start codon + CDS Deleted
ENSMUSE00001006391 CDS Deleted
ENSMUSE00000983442 Znf_MYND (15/47 aa) CDS Deleted
ENSMUSE00001056466 Znf_MYND (33/47 aa) CDS Deleted
ENSMUSE00001092040 CDS Deleted
ENSMUSE00000965205 CDS Deleted
ENSMUSE00000964277 CDS Deleted
ENSMUSE00001025674 CDS Deleted
ENSMUSE00001067963 CDS Deleted
ENSMUSE00001077306 CDS Deleted
ENSMUSE00000321981 CDS Deleted
ENSMUSE00000321972 CDS Deleted
ENSMUSE00000677223 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000126105 protein_coding No analysis available: incomplete transcript
ENSMUST00000147289 protein_coding No protein product
ENSMUST00000136029 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 105892 Deletion (Promotor Driven Cassette) DPGS00142_A_A01 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 105892 Deletion (Promotor Driven Cassette) PG00142_Z_3_A01 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 105892 Deletion (Promotor Driven Cassette) PG00142_Z_4_A01 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 105892 Deletion (Promotor Driven Cassette) PG00142_Z_1_A02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 105892 Deletion (Promotor Driven Cassette) PG00142_Z_3_H03 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
105892 Deletion PCS00142_A_A01