IKMC Project Report - KOMP-CSD (ID: 36522)

1110032A03Rik MGI:1915971 ENSMUSG00000037971 OTTMUSG00000042097
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000042468 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MAVSCSLNHSTYLQDLNESLTGFLDISLSWILLTTNAQRSQLI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000953798 UPF0686 (13/149 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000283748 UPF0686 (77/149 aa) CDS Deleted
ENSMUSE00000283717 UPF0686 (23/149 aa) CDS Deleted
ENSMUSE00000283627 UPF0686 (37/149 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000042576 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MELPYRNRFYSLRCSSKSLYSPSSYTSIIQDLNESLTGFLDISLSWILLTTNAQRSQLI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000283779 UPF0686 (4/140 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000283748 UPF0686 (77/140 aa) CDS Deleted
ENSMUSE00000283717 UPF0686 (23/140 aa) CDS Deleted
ENSMUSE00000950366 UPF0686 (37/140 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176238 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MAVSCSLNHSTYLQDLNESLTGFLDISLSWILLTTNAQRSQLI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000283645 UPF0686 (13/70 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000947712 UPF0686 (54/70 aa) CDS Deleted
ENSMUSE00000283717 UPF0686 (3/70 aa) | UPF0686 (22/58 aa) CDS Deleted
ENSMUSE00000960992 UPF0686 (37/58 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000177546 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MAVSCSLNHSTYLQDLNESLTGFLDISLSWILLTTNAQRSQLI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000950001 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000283717 UPF0686 (23/59 aa) CDS Deleted
ENSMUSE00000952720 UPF0686 (37/59 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176894 retained_intron No analysis available: incomplete transcript
ENSMUST00000177142 processed_transcript No analysis available: incomplete transcript
ENSMUST00000176682 retained_intron No analysis available: incomplete transcript
ENSMUST00000177022 processed_transcript No analysis available: incomplete transcript
ENSMUST00000176160 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 213511 Deletion (Promotor Driven Cassette) PG00158_Y_8_B11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213511 Deletion (Promotor Driven Cassette) DPGS00158_A_B11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213511 Deletion (Promotor Driven Cassette) PG00158_Y_4_B11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213511 Deletion (Promotor Driven Cassette) PG00158_Y_2_B11 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
213511 Deletion PCS00158_A_B11