IKMC Project Report - KOMP-CSD (ID: 36847)
L1cam MGI:96721 ENSMUSG00000031391 OTTMUSG00000016517
Mice no data available
Mutagenesis Predictions
This gene has 13 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||
|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000102871 | protein_coding | No protein product (NMD) | view | |||||||
|
Predicted translation: MVVMLRYVWPLLLCSPCLLIQIPDESLHPPSSGCTPVTQCQQTVLSTKTTTRPCNYSMWAKRTMASIPALLRTRWAVPGM PTMLLWKLPHIGCRSPRAICMVQERLPA*
|
||||||||||
| ENSMUST00000114430 | protein_coding | No analysis available: incomplete transcript | ||||||||
| ENSMUST00000066576 | protein_coding | No analysis available: incomplete transcript | ||||||||
| ENSMUST00000146790 | protein_coding | No analysis available: incomplete transcript | ||||||||
| ENSMUST00000148250 | protein_coding | Target region does not overlap transcript | ||||||||
| ENSMUST00000124560 | protein_coding | Target region does not overlap transcript | ||||||||
| ENSMUST00000129612 | retained_intron | No analysis available: incomplete transcript | ||||||||
| ENSMUST00000130110 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000145805 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000144478 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000155246 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000135104 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000141221 | processed_transcript | No analysis available: incomplete transcript | ||||||||