IKMC Project Report - KOMP-CSD (ID: 37046)

1700008F21Rik MGI:1922703 ENSMUSG00000056018 OTTMUSG00000022627
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000108745 protein_coding Residual C-terminal product view

Predicted translation: 

METNYENLILKKNLLEGEIQRLRDPERVKSATKLERTKKPGKSEKKKDKDLERNISPNREFKSFEELHQIQETERNKTQL
DNVLPQKSEMFKEERTKTKRGQSQNKSKVKIEDSKDSLPKKSDTQLGEQRKDQISSDQSKRSVSERAK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000313448 UTR UTR
ENSMUSE00000970454 UTR UTR
ENSMUSE00001058573 UTR Deleted
ENSMUSE00000983741 UTR + start codon + CDS Deleted
ENSMUSE00001065727 CDS Deleted
ENSMUSE00001045240 CDS UTR + start codon + CDS
ENSMUSE00001009816 CDS CDS
ENSMUSE00000991760 CDS CDS
ENSMUSE00000510009 CDS CDS
ENSMUSE00000677887 CDS CDS
ENSMUSE00000677886 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000026912 protein_coding No protein product (NMD) view

Predicted translation: 

MKRAKHPSNISVKLTSVPELPYNKGLLNSSPKPKEKHNAKSTPDKIEPMVIRSPPTGESIVRYALPIPSTMMKDLVSDAE
MVRRIATNMKMILESLFKWFQQQVNQIEEIGKDSLQKDRPSDVKFVKKNITQIARLMHKIEHIRGRLRERNLSTQSKKMD
KEIPPELIKSYGLVEKQIEEI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000313448 UTR UTR
ENSMUSE00000981434 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001059105 CDS CDS
ENSMUSE00001075257 CDS CDS
ENSMUSE00000972840 CDS CDS
ENSMUSE00001057501 CDS CDS
ENSMUSE00001017963 CDS Deleted
ENSMUSE00000968280 CDS Deleted
ENSMUSE00001065727 CDS Deleted
ENSMUSE00001045240 CDS CDS + stop codon + UTR
ENSMUSE00001009816 CDS
ENSMUSE00000991760 CDS
ENSMUSE00000510009 CDS
ENSMUSE00000511030 CDS
ENSMUSE00000677886 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108744 protein_coding Residual C-terminal product view

Predicted translation: 

METNYENLILKKNLLEGEIQRLRDPERVKSATKLERTKKPGKSEKKKDKDLERNISPNREFKSFEELHQIQETERNKTQL
DNVLPQKSEMFKEERTKTKRGQSQNKSKVKIEDSKDSLPKKSDTQLGEQRKDQISSDQSKRAK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000677885 UTR UTR
ENSMUSE00000559750 UTR UTR
ENSMUSE00000985738 UTR UTR
ENSMUSE00001058573 UTR Deleted
ENSMUSE00000983741 UTR + start codon + CDS Deleted
ENSMUSE00001065727 CDS Deleted
ENSMUSE00001045240 CDS UTR + start codon + CDS
ENSMUSE00001009816 CDS CDS
ENSMUSE00000991760 CDS CDS
ENSMUSE00000510009 CDS CDS
ENSMUSE00000511030 CDS CDS
ENSMUSE00000677883 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000148621 protein_coding No analysis available: incomplete transcript
ENSMUST00000148234 protein_coding No analysis available: incomplete transcript
ENSMUST00000140887 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order DEPD00512_3_E06 DPGS00170_A_B01 1700008F21Riktm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00512_3_A05 DPGS00170_A_B01 1700008F21Riktm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00512_3_C07 DPGS00170_A_B01 1700008F21Riktm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_8_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_1_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_7_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_2_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_3_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_6_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_5_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) PG00170_Z_4_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 232225 Deletion (Promotor Driven Cassette) DPGS00170_A_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
232225 Deletion PCS00170_A_B01