IKMC Project Report - KOMP-CSD (ID: 37207)

R3hcc1 MGI:1919093 ENSMUSG00000034194 OTTMUSG00000029904
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000118374 protein_coding No protein product (NMD) view

Predicted translation: 

MLVTQELLKSPDPGHANEPQMGLGDTEPSENPEKEQGAETAVQQGSGAQLAMEEENRSHGMRSLVDQEEEEIEGEEEEKV
DEKEEDTGKQKERVDEEEEKTDAQEGKVDSEGERMDEGEDKVDAEEEDEDEADADHGDFSELLQEREGIQNPVGG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000712978 UTR UTR
ENSMUSE00001048684 UTR UTR
ENSMUSE00001056008 UTR UTR
ENSMUSE00000996434 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000264042 CDS Deleted
ENSMUSE00000264034 CDS CDS + stop codon + UTR
ENSMUSE00000264026 CDS
ENSMUSE00000713088 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000121142 protein_coding No protein product (NMD) view

Predicted translation: 

MLVTQELLKSPDPGHANEPQMGLGDTEPSENPEKEQGAETAVQQGSGAQLAMEEENRSHGMRSLVDQEEEEIEGEEEEKV
DEKEEDTGKQKERVDEEEEKTDAQEGKVDSEGERMDEGEDKVDAEEEDEDEADADHGDFSELLQEREGIQNPVGG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000712182 UTR UTR
ENSMUSE00001056008 UTR UTR
ENSMUSE00000996434 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000264042 CDS Deleted
ENSMUSE00000264034 CDS CDS + stop codon + UTR
ENSMUSE00000264026 CDS
ENSMUSE00000712609 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000128747 retained_intron No analysis available: incomplete transcript
ENSMUST00000147609 processed_transcript Target region does not overlap transcript
ENSMUST00000138326 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00067_Z_3_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00067_Z_4_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00067_Z_1_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00067_Z_7_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00067_Z_8_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47965 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00067_A_D09 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47965 Knockout First, Reporter-tagged insertion with conditional potential PCS00067_A_D09