IKMC Project Report - KOMP-CSD (ID: 37574)

Bsg MGI:88208 ENSMUSG00000023175 OTTMUSG00000042290
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000067036 protein_coding Novel C-terminal product view

Predicted translation: 

MQTIHSLGVYVFIFPSLLKCCHYSPVEWGNGALSLVRREG

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001048439 UTR + start codon + CDS
ENSMUSE00000452028 Ig_I-set (84/84 aa) | Immunoglobulin (74/74 aa) CDS Deleted
ENSMUSE00001004527 CDS Deleted
ENSMUSE00001094367 CDS Deleted
ENSMUSE00001002222 Ig_I-set (40/97 aa) | Ig_V-set (36/84 aa) CDS Deleted
ENSMUSE00000133854 Ig_I-set (57/97 aa) | Ig_V-set (48/84 aa) CDS Deleted
ENSMUSE00001018871 CDS Deleted
ENSMUSE00000966066 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000179781 protein_coding Novel C-terminal product view

Predicted translation: 

MQTIHSLGVYVFIFPSLLKCCHYSPVEWGNGALSLVRREGQCML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000963424 UTR + start codon + CDS
ENSMUSE00001004527 CDS Deleted
ENSMUSE00001094367 CDS Deleted
ENSMUSE00001002222 Ig_I-set (40/97 aa) | Ig_V-set (36/85 aa) CDS Deleted
ENSMUSE00000133854 Ig_I-set (57/97 aa) | Ig_V-set (49/85 aa) CDS Deleted
ENSMUSE00001018871 CDS Deleted
ENSMUSE00000452010 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105381 protein_coding Design floxes first exon in transcript ENSMUST00000105381
ENSMUST00000178383 protein_coding No analysis available: incomplete transcript
ENSMUST00000180235 retained_intron No analysis available: incomplete transcript
ENSMUST00000179201 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 214177 Deletion (Promotor Driven Cassette) PG00161_Z_3_F10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 214177 Deletion (Promotor Driven Cassette) DPGS00161_A_F10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 214177 Deletion (Promotor Driven Cassette) PG00161_Z_1_F10 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
214177 Deletion PCS00161_A_F10