IKMC Project Report - EUCOMM (ID: 37847)

Tnfrsf8 MGI:99908 ENSMUSG00000028602 OTTMUSG00000010015
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030339 protein_coding No protein product (NMD) view

Predicted translation:

MSALLTAAGLLFLGMLQAFPTGCLRHSHAHGVLPTAGSSVHLTTTSMKTGSAQPA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000726432 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000180533 CDS Deleted
ENSMUSE00000180527 TNFR/NGFR_Cys_rich_reg (21/37 aa) CDS CDS + stop codon + UTR
ENSMUSE00000180534 TNFR/NGFR_Cys_rich_reg (17/37 aa) CDS
ENSMUSE00000180529 CDS
ENSMUSE00000377859 CDS
ENSMUSE00000222549 CDS
ENSMUSE00000222543 CDS
ENSMUSE00000984954 CDS
ENSMUSE00001068364 CDS
ENSMUSE00001016950 CDS
ENSMUSE00000222519 CDS
ENSMUSE00000725902 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123027 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MSALLTAAGLLFLGMLQAFPTGCLRHSHAHGVLPTAGSSVHLTTTSMKTGSAQPA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000180531 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000180533 CDS Deleted
ENSMUSE00000180527 TNFR/NGFR_Cys_rich_reg (21/37 aa) CDS CDS + stop codon + UTR
ENSMUSE00000180534 TNFR/NGFR_Cys_rich_reg (17/37 aa) CDS
ENSMUSE00000180529 CDS
ENSMUSE00000377859 CDS
ENSMUSE00000222549 CDS
ENSMUSE00000222543 CDS
ENSMUSE00000808906 CDS
ENSMUSE00000985856 CDS + stop codon + UTR
ENSMUSE00001053441 UTR UTR
ENSMUSE00000978443 UTR UTR
ENSMUSE00000595798 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available