IKMC Project Report - KOMP-CSD (ID: 37883)

1700016D06Rik MGI:1923663 ENSMUSG00000031509
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033906 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MTANRGAMTFLSVFLLCCWQDVQPWPNRELSDKQKEILFQLRSLEALEKMIDKIRRAIETKLKRRQKLQQSRSSQLLGKP
IQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000210347 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000210350 CDS Deleted
ENSMUSE00000210348 CDS Deleted
ENSMUSE00000210351 CDS Deleted
ENSMUSE00000210352 CDS CDS
ENSMUSE00000375787 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0401_4_H01 DPGS00166_A_C08 1700016D06Riktm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0401_4_G01 DPGS00166_A_C08 1700016D06Riktm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0401_4_A01 DPGS00166_A_C08 1700016D06Riktm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0401_4_A02 DPGS00166_A_C08 1700016D06Riktm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_4_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_1_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_5_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_2_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_8_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_6_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_3_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) PG00166_Z_7_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213300 Deletion (Promotor Driven Cassette) DPGS00166_A_C08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
213300 Deletion PCS00166_A_C08