IKMC Project Report - KOMP-CSD (ID: 38000)

Zfp354a MGI:103172 ENSMUSG00000020364 OTTMUSG00000005592
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000109119 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAPEQWEATSQVSLTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLAGFPFTKPKVISLLQQGEDPWKVEEEG
PGGFSL

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000679090 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029153 Krueppel-associated_box (40/40 aa) CDS CDS
ENSMUSE00000579999 Krueppel-associated_box (1/40 aa) CDS CDS + stop codon + UTR
ENSMUSE00000662539 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (22/22 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000102766 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAPEQWEATSQVSLTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLGFPFTKPKVISLLQQGEDPWKVEEEGP
GGFSL

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662542 UTR UTR
ENSMUSE00000662541 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029153 Krueppel-associated_box (40/41 aa) CDS CDS
ENSMUSE00001036300 Krueppel-associated_box (2/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000835033 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (22/22 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000020628 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAPEQWEATSQVSLTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLGFPFTKPKVISLLQQGEDPWKVEEEGP
GGFSL

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000653801 CDS CDS
ENSMUSE00001029153 Krueppel-associated_box (40/41 aa) CDS CDS
ENSMUSE00001036300 Krueppel-associated_box (2/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000295363 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (22/22 aa) | Znf_C2H2 (23/23 aa) CDS Deleted
Legend: in frame deleted frameshifted
ENSMUST00000109122 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLLLTGAEQQVSLTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLGFPFTKPKVISLLQQGEDPWKVEEEGPG
GFSL

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000679096 UTR UTR
ENSMUSE00000679095 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029153 Krueppel-associated_box (40/41 aa) CDS CDS
ENSMUSE00001036300 Krueppel-associated_box (2/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000679094 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (22/22 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000156914 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44235 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00048_A_1_E04 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44235 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00048_A_4_E04 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44235 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00048_A_3_E04 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44235 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00048_A_E04 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44235 Knockout-First - Reporter Tagged Insertion PCS00048_A_E04