IKMC Project Report - KOMP-CSD (ID: 38021)

Dpysl2 MGI:1349763 ENSMUSG00000022048 OTTMUSG00000016382
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022629 protein_coding No protein product (NMD) view

Predicted translation: 

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000267871 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000557151 CDS CDS
ENSMUSE00000557148 Amidohydro_1 (41/350 aa) CDS Deleted
ENSMUSE00000267938 Amidohydro_1 (56/350 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267932 Amidohydro_1 (21/350 aa) CDS
ENSMUSE00000267925 Amidohydro_1 (27/350 aa) CDS
ENSMUSE00000267915 Amidohydro_1 (23/350 aa) CDS
ENSMUSE00000123201 Amidohydro_1 (41/350 aa) CDS
ENSMUSE00000557132 Amidohydro_1 (53/350 aa) CDS
ENSMUSE00000123202 Amidohydro_1 (48/350 aa) CDS
ENSMUSE00000123192 Amidohydro_1 (44/350 aa) CDS
ENSMUSE00000123193 CDS
ENSMUSE00000123205 CDS
ENSMUSE00000123197 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0110_2_G07 PRPGS00027_A_F11 Dpysl2tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0110_2_D07 PRPGS00027_A_F11 Dpysl2tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 38974 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00027_A_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38974 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00027_Y_1_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38974 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00027_Y_5_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38974 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00027_Y_6_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38974 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00027_Y_8_F11 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
38974 Knockout-First - Reporter Tagged Insertion PCS00027_A_F11