IKMC Project Report - KOMP-CSD (ID: 38323)

Krt25 MGI:1918060 ENSMUSG00000035831 OTTMUSG00000006453
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000038004 protein_coding No protein product (NMD) view

Predicted translation: 

MSLRLSSGSRRSYARPSTGSLRGASFGAGNACGVAGIGSGFSCAFGGSSTGGNTGVANSCAGFTVNEGGLLSGNEKVTMQ
NLNDRLASYLDNVQALQEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIITSTTSNANAVLQIDNARLT
ADDFRLKKCRLCSAPLEAT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000251965 F (65/314 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000972994 F (28/314 aa) CDS CDS
ENSMUSE00001078145 F (53/314 aa) CDS Deleted
ENSMUSE00001021422 F (54/314 aa) CDS CDS + stop codon + UTR
ENSMUSE00001062606 F (42/314 aa) CDS
ENSMUSE00001083156 F (73/314 aa) CDS
ENSMUSE00000251933 F (1/314 aa) CDS
ENSMUSE00000340863 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0731_4_C06 PG00027_Y_5_G12 Krt25tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) fail Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_4_D05 PG00027_Y_5_G12 Krt25tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) fail Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_4_F05 PG00027_Y_5_G12 Krt25tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_4_C05 PG00027_Y_5_G12 Krt25tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_5_G12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_6_G12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_8_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_7_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_4_G12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_5_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00027_A_H11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_2_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_4_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 38468 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00027_Y_3_H12 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
38468 Knockout First, Reporter-tagged insertion with conditional potential PCS00027_A_H11