IKMC Project Report - EUCOMM (ID: 38409)

Capzb MGI:104652 ENSMUSG00000028745 OTTMUSG00000009900
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) EPD0105_5_A09 C57BL/6Dnk or C57BL/6NTac;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/CNB
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 11 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000102507 protein_coding No protein product (NMD) view

Predicted translation: 

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVTVE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661782 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000973301 WASH_F-actin_cap_beta (26/236 aa) CDS CDS
ENSMUSE00001039264 WASH_F-actin_cap_beta (41/236 aa) CDS Deleted
ENSMUSE00000980028 WASH_F-actin_cap_beta (39/236 aa) CDS CDS + stop codon + UTR
ENSMUSE00000861426 WASH_F-actin_cap_beta (48/236 aa) CDS
ENSMUSE00001032134 WASH_F-actin_cap_beta (39/236 aa) CDS
ENSMUSE00001078865 WASH_F-actin_cap_beta (22/236 aa) CDS
ENSMUSE00001053861 WASH_F-actin_cap_beta (23/236 aa) CDS
ENSMUSE00000977050 CDS + stop codon + UTR
ENSMUSE00000661778 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000102508 protein_coding No protein product (NMD) view

Predicted translation: 

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVTVE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000843466 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000973301 WASH_F-actin_cap_beta (26/236 aa) CDS CDS
ENSMUSE00001039264 WASH_F-actin_cap_beta (41/236 aa) CDS Deleted
ENSMUSE00000980028 WASH_F-actin_cap_beta (39/236 aa) CDS CDS + stop codon + UTR
ENSMUSE00000861426 WASH_F-actin_cap_beta (48/236 aa) CDS
ENSMUSE00001032134 WASH_F-actin_cap_beta (39/236 aa) CDS
ENSMUSE00001078865 WASH_F-actin_cap_beta (22/236 aa) CDS
ENSMUSE00001053861 WASH_F-actin_cap_beta (23/236 aa) CDS
ENSMUSE00000834394 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000030518 protein_coding No protein product (NMD) view

Predicted translation: 

MHPSRRSLPFPLNCQLVRVGTADYGGASEQSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVTVE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000839016 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000973301 WASH_F-actin_cap_beta (26/236 aa) CDS CDS
ENSMUSE00001039264 WASH_F-actin_cap_beta (41/236 aa) CDS Deleted
ENSMUSE00000980028 WASH_F-actin_cap_beta (39/236 aa) CDS CDS + stop codon + UTR
ENSMUSE00000861426 WASH_F-actin_cap_beta (48/236 aa) CDS
ENSMUSE00001032134 WASH_F-actin_cap_beta (39/236 aa) CDS
ENSMUSE00001078865 WASH_F-actin_cap_beta (22/236 aa) CDS
ENSMUSE00001053861 WASH_F-actin_cap_beta (23/236 aa) CDS
ENSMUSE00000789064 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000042675 protein_coding Residual C-terminal product view

Predicted translation: 

MPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHY
KLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQ
TFADKSKQEALKNDLVEALKRKQQC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000667590 UTR UTR
ENSMUSE00000969686 WASH_F-actin_cap_beta (18/228 aa) UTR + start codon + CDS
ENSMUSE00001039264 WASH_F-actin_cap_beta (41/228 aa) CDS Deleted
ENSMUSE00000980028 WASH_F-actin_cap_beta (39/228 aa) CDS UTR + start codon + CDS
ENSMUSE00000861426 WASH_F-actin_cap_beta (48/228 aa) CDS CDS
ENSMUSE00001032134 WASH_F-actin_cap_beta (39/228 aa) CDS CDS
ENSMUSE00001078865 WASH_F-actin_cap_beta (22/228 aa) CDS CDS
ENSMUSE00001053861 WASH_F-actin_cap_beta (23/228 aa) CDS CDS
ENSMUSE00000667589 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000138045 protein_coding No analysis available: incomplete transcript
ENSMUST00000131912 protein_coding No analysis available: incomplete transcript
ENSMUST00000145368 protein_coding No analysis available: incomplete transcript
ENSMUST00000150077 processed_transcript No analysis available: incomplete transcript
ENSMUST00000156760 retained_intron Target region does not overlap transcript
ENSMUST00000132385 processed_transcript Target region does not overlap transcript
ENSMUST00000131793 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0105_5_A09 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_A11 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_B10 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_B12 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_D09 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_D11 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_D12 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_E09 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_E11 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_G10 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_H11 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0105_5_H12 PRPGS00063_A_E03 Capzbtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47322 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00063_A_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47322 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00063_Z_2_E03 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47322 Knockout First, Reporter-tagged insertion with conditional potential PCS00063_B_E03
47322 Knockout First, Reporter-tagged insertion with conditional potential PCS00063_A_E03