IKMC Project Report - KOMP-CSD (ID: 38728)

Fam107b MGI:1913790 ENSMUSG00000026655 OTTMUSG00000010781
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Fam107btm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) EPD0084_1_B08 C57BL/6Dnk or C57BL/6NTac;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027965 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMPQSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000331389 UTR UTR
ENSMUSE00001015250 DUF1151 (42/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001001890 DUF1151 (51/120 aa) CDS Deleted
ENSMUSE00000701560 DUF1151 (28/120 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115052 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLSDGPLENIDPKDSCLIPRNIMAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMP
QSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000955113 UTR UTR
ENSMUSE00000952453 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001044778 DUF1151 (42/120 aa) CDS CDS
ENSMUSE00001001890 DUF1151 (51/120 aa) CDS Deleted
ENSMUSE00000956071 DUF1151 (28/120 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115053 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMPQSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701557 UTR UTR
ENSMUSE00000701556 UTR UTR
ENSMUSE00001015250 DUF1151 (42/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001001890 DUF1151 (51/120 aa) CDS Deleted
ENSMUSE00000960699 DUF1151 (28/120 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115054 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMPQSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701558 UTR UTR
ENSMUSE00001015250 DUF1151 (42/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001001890 DUF1151 (51/120 aa) CDS Deleted
ENSMUSE00000960699 DUF1151 (28/120 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115055 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMPQSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701562 UTR UTR
ENSMUSE00001015250 DUF1151 (42/120 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001001890 DUF1151 (51/120 aa) CDS Deleted
ENSMUSE00000960699 DUF1151 (28/120 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176254 protein_coding No protein product
ENSMUST00000177037 protein_coding Target region does not overlap transcript
ENSMUST00000177125 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKSLNLRSRNCKKSKKMPQSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701557 UTR UTR
ENSMUSE00001015250 DUF1151 (42/44 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000951824 DUF1151 (3/44 aa) CDS + stop codon + UTR Deleted
ENSMUSE00000947089 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0084_1_B08 PRPGS00052_A_D05 Fam107btm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0084_1_D08 PRPGS00052_A_D05 Fam107btm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0084_1_E05 PRPGS00052_A_D05 Fam107btm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0084_1_E06 PRPGS00052_A_D05 Fam107btm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44323 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00052_Z_4_D05 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 44323 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00052_A_D05 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44323 Knockout First, Reporter-tagged insertion with conditional potential PCS00052_A_D05