IKMC Project Report - EUCOMM (ID: 38783)

Dnajc10 MGI:1914111 ENSMUSG00000027006 OTTMUSG00000013339
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Dnajc10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HEPD0507_5_B06 C57BL/6NTac;C57BL/6NTac;C57BL/6N view
( about ) 		Harwell
Southern Blot pass TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000028392 protein_coding No protein product (NMD) view

Predicted translation: 

MGVWLNKDDFIRDLKRISLCLLILYVVVVVGTDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPVFTMMILKS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000477397 UTR UTR
ENSMUSE00001031658 DnaJ_N (33/63 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061950 DnaJ_N (30/63 aa) CDS Deleted
ENSMUSE00001075061 Thioredoxin_domain (9/101 aa) CDS CDS + stop codon + UTR
ENSMUSE00000403421 Thioredoxin_domain (28/101 aa) CDS
ENSMUSE00000165376 Thioredoxin_domain (44/101 aa) CDS
ENSMUSE00000165375 Thioredoxin_domain (21/101 aa) CDS
ENSMUSE00000165370 CDS
ENSMUSE00000240006 CDS
ENSMUSE00000239999 CDS
ENSMUSE00000165371 CDS
ENSMUSE00000165379 CDS
ENSMUSE00001017723 CDS
ENSMUSE00000974487 Thioredoxin_domain (12/86 aa) CDS
ENSMUSE00000239958 Thioredoxin_domain (39/86 aa) CDS
ENSMUSE00000239949 Thioredoxin_domain (34/86 aa) CDS
ENSMUSE00000428676 Thioredoxin_domain (1/86 aa) | Thioredoxin_domain (45/87 aa) CDS
ENSMUSE00000239906 Thioredoxin_domain (42/87 aa) CDS
ENSMUSE00000239898 CDS
ENSMUSE00000239888 Thioredoxin_domain (41/86 aa) CDS
ENSMUSE00001009341 Thioredoxin_domain (40/86 aa) CDS
ENSMUSE00000413886 Thioredoxin_domain (5/86 aa) CDS
ENSMUSE00000688937 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125000 processed_transcript No analysis available: incomplete transcript
ENSMUST00000133536 processed_transcript Target region does not overlap transcript
ENSMUST00000154912 processed_transcript Target region does not overlap transcript
ENSMUST00000153093 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0507_5_B06 PRPGS00039_A_F02 Dnajc10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot fail both ends Map Test pass Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0507_5_A05 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0507_5_E05 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0507_5_E07 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0507_5_G08 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0507_5_H05 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0507_5_H06 PRPGS00039_A_F02 Dnajc10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 27543 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00039_A_F02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 27543 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00039_Z_1_F02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 27543 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00039_Z_3_F02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 27543 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00039_Z_4_F02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 27543 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00039_Z_2_F02 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
27543 Knockout First, Reporter-tagged insertion with conditional potential PCS00039_A_F02