IKMC Project Report - KOMP-CSD (ID: 39169)

Gulp1 MGI:1920407 ENSMUSG00000056870 OTTMUSG00000030324
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000074525 protein_coding No protein product (NMD) view

Predicted translation:

MNRAFSRKKVSWQYRSGAAKGNRSCERCCQEAEVCKTHQKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000548899 UTR UTR
ENSMUSE00001040599 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000986011 PTyr_interaction_dom (3/128 aa) | PTB (3/118 aa) CDS Deleted
ENSMUSE00001069439 PTyr_interaction_dom (24/128 aa) | PTB (24/118 aa) CDS CDS
ENSMUSE00001003008 PTyr_interaction_dom (33/128 aa) | PTB (33/118 aa) CDS CDS + stop codon + UTR
ENSMUSE00001065596 PTyr_interaction_dom (46/128 aa) | PTB (46/118 aa) CDS
ENSMUSE00001020380 PTyr_interaction_dom (22/128 aa) | PTB (12/118 aa) CDS
ENSMUSE00001047696 CDS
ENSMUSE00000981832 CDS
ENSMUSE00001062646 CDS
ENSMUSE00000850197 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160854 protein_coding No protein product (NMD) view

Predicted translation:

MNRAFSRKKVSWQYRSGAAKGNRSCERCCQEAEVCKTHQKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856990 UTR UTR
ENSMUSE00001040599 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000986011 PTyr_interaction_dom (3/128 aa) | PTB (3/118 aa) CDS Deleted
ENSMUSE00001069439 PTyr_interaction_dom (24/128 aa) | PTB (24/118 aa) CDS CDS
ENSMUSE00001003008 PTyr_interaction_dom (33/128 aa) | PTB (33/118 aa) CDS CDS + stop codon + UTR
ENSMUSE00001065596 PTyr_interaction_dom (46/128 aa) | PTB (46/118 aa) CDS
ENSMUSE00001020380 PTyr_interaction_dom (22/128 aa) | PTB (12/118 aa) CDS
ENSMUSE00001047696 CDS
ENSMUSE00000981832 CDS
ENSMUSE00000856120 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162600 protein_coding No analysis available: incomplete transcript
ENSMUST00000161066 protein_coding No analysis available: incomplete transcript
ENSMUST00000159555 nonsense_mediated_decay Design floxes no exons in transcript ENSMUST00000159555
ENSMUST00000161793 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available