IKMC Project Report - KOMP-CSD (ID: 39328)

Adam3 MGI:102518 ENSMUSG00000031553 OTTMUSG00000035967
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Adam3tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) EPD0272_2_D07 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033958 protein_coding No protein product (NMD) view

Predicted translation: 

MLPLFLVLSYLGQVIAAGKDVETPLLQITVPEKIDTNIQDAKEAETQVTYVVRIEGKAYTLQLEKQSFLHPLFGTYLRDK
LGTLQPYFSLVKTHCFYQGHAAEIPVSTVTLSTCSGLRGLLQLENITYGIEPLESSATFEHILYEIKNNKIDYSPLKENF
ANSEQESQSYRILVKPEKGSNSTLTKRILRIKIIMDKAMFDHMGSEVGVATQKVVHIFGLINTMFSQLKMTVMLNSLEIW
SEQDKIETNGDADEVLQRFLLWKSKEISQKAQDITYLLLYKDHPDYVGATYHGMACNPNFTAGIALHPKTLAVEGFAIVL
SQLLGINLGLAYDDVYNCFCPGSTCIMNPSAMFASEEIAYVCMS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000890663 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001080990 Peptidase_M12B_N (23/121 aa) CDS CDS
ENSMUSE00001002662 Peptidase_M12B_N (19/121 aa) CDS CDS
ENSMUSE00001055017 Peptidase_M12B_N (27/121 aa) CDS CDS
ENSMUSE00000986341 Peptidase_M12B_N (26/121 aa) CDS CDS
ENSMUSE00001080956 Peptidase_M12B_N (28/121 aa) CDS CDS
ENSMUSE00001027654 Peptidase_M12B (12/197 aa) CDS CDS
ENSMUSE00000973973 Peptidase_M12B (24/197 aa) CDS CDS
ENSMUSE00000990606 Peptidase_M12B (56/197 aa) CDS CDS
ENSMUSE00000984804 Peptidase_M12B (28/197 aa) CDS CDS
ENSMUSE00000998729 Peptidase_M12B (46/197 aa) CDS CDS
ENSMUSE00001009464 Peptidase_M12B (33/197 aa) | Blood-coag_inhib_Disintegrin (10/76 aa) CDS Deleted
ENSMUSE00001046952 Blood-coag_inhib_Disintegrin (33/76 aa) CDS Deleted
ENSMUSE00001005552 ADAM_Cys-rich (29/110 aa) | Blood-coag_inhib_Disintegrin (33/76 aa) CDS Deleted
ENSMUSE00000982296 ADAM_Cys-rich (30/110 aa) CDS Deleted
ENSMUSE00001011678 ADAM_Cys-rich (53/110 aa) CDS Deleted
ENSMUSE00000993062 EGF_extracell (10/30 aa) CDS CDS + stop codon + UTR
ENSMUSE00001061925 EGF_extracell (20/30 aa) CDS
ENSMUSE00001006588 CDS
ENSMUSE00000963768 CDS
ENSMUSE00001026276 CDS + stop codon + UTR
ENSMUSE00000684842 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000171438 protein_coding No analysis available: incomplete transcript
ENSMUST00000171611 protein_coding Target region does not overlap transcript
ENSMUST00000167431 protein_coding Target region does not overlap transcript
ENSMUST00000170318 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MLPLFLVLSYLGQVIAAGKDVETPLLQITVPEKIDTNIQDAKEAETQVTYVVRIEGKAYTLQLEKQSFLHPLFGTYLRDK
LGTLQPYFSLVKTHCFYQGHAAEIPVSTVTLSTCSGVCCS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000915753 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001080990 Peptidase_M12B_N (24/94 aa) CDS CDS
ENSMUSE00001002662 Peptidase_M12B_N (19/94 aa) CDS CDS
ENSMUSE00001055017 Peptidase_M12B_N (27/94 aa) CDS CDS
ENSMUSE00000916234 Peptidase_M12B_N (24/94 aa) CDS CDS
ENSMUSE00001073164 Peptidase_M12B_N (2/94 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000995921 UTR UTR
ENSMUSE00001059357 UTR UTR
ENSMUSE00001056288 UTR UTR
ENSMUSE00001036707 UTR UTR
ENSMUSE00000991872 UTR UTR
ENSMUSE00001003963 UTR Deleted
ENSMUSE00000967475 UTR Deleted
ENSMUSE00000994278 UTR Deleted
ENSMUSE00001022006 UTR Deleted
ENSMUSE00001035330 UTR Deleted
ENSMUSE00001038463 UTR UTR
ENSMUSE00001083555 UTR UTR
ENSMUSE00001023758 UTR UTR
ENSMUSE00001075458 UTR UTR
ENSMUSE00001030471 UTR UTR
ENSMUSE00000897347 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000169598 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000167703 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000166986 processed_transcript Target region does not overlap transcript
ENSMUST00000170740 processed_transcript Target region does not overlap transcript
ENSMUST00000168662 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0272_2_D07 DPGS00107_A_C12 Adam3tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0272_2_A10 DPGS00107_A_C12 Adam3tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0272_2_H12 DPGS00107_A_C12 Adam3tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 97069 Deletion (Promotor Driven Cassette) PG00107_Z_1_C12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 97069 Deletion (Promotor Driven Cassette) PG00107_Y_2_C12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 97069 Deletion (Promotor Driven Cassette) PG00107_Z_2_C12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 97069 Deletion (Promotor Driven Cassette) DPGS00107_A_C12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 97069 Deletion (Promotor Driven Cassette) PG00107_Z_4_C12 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
97069 Deletion PCS00107_A_C12