IKMC Project Report - KOMP-CSD (ID: 39357)

Jakmip1 MGI:1923321 ENSMUSG00000063646 OTTMUSG00000026769
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 12 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000043794 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MSKKGRSKGDKPEAETDSVQMANEELRAKLTNIQIEFQQEKSKVGKLRERLQEAKLEREQEQRRHTAYISELKAKLHEEK
TKELQALREALIRQHEQEAARTAKIKEGELQRLQATLNVLRDGAADKVKTALLADAREEARRTFDGERQRLQQEILELKA
ARKQAEEALSNCMQADKAKAADLRAAYQAHQDEVHRIKRECERDIRRLKHVVETFFGFDEESVDSETLSETSYNTDRTDR
TPATPEEDLDETTTREEADLRFCQLTREYQALQRAYALLQEQVGGTLDAEREARTREQLQADLLRCQAKIEDLEKLLVEK
GQDAAWVEEKQVLMRTNQDLLEKIYRLEMEENQLKSEMQDAKDQNELLEFRVLELEVRDSICCKLSNGADILFEPKLKFM
*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000932892 UTR UTR
ENSMUSE00000404674 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000285025 CDS CDS
ENSMUSE00000285017 CDS Deleted
ENSMUSE00000285010 CDS Deleted
ENSMUSE00000285004 CDS Deleted
ENSMUSE00000284996 CDS Deleted
ENSMUSE00000284985 CDS Deleted
ENSMUSE00000284977 CDS CDS
ENSMUSE00000284970 CDS CDS
ENSMUSE00000508795 CDS CDS
ENSMUSE00000284961 CDS CDS
ENSMUSE00000284957 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000121010 protein_coding No analysis available: incomplete transcript
ENSMUST00000174629 protein_coding No analysis available: incomplete transcript
ENSMUST00000137019 protein_coding No analysis available: incomplete transcript
ENSMUST00000172917 protein_coding Target region does not overlap transcript
ENSMUST00000173836 protein_coding Target region does not overlap transcript
ENSMUST00000174097 protein_coding Target region does not overlap transcript
ENSMUST00000152445 retained_intron Target region does not overlap transcript
ENSMUST00000147014 retained_intron Target region does not overlap transcript
ENSMUST00000126527 retained_intron Target region does not overlap transcript
ENSMUST00000172940 processed_transcript Target region does not overlap transcript
ENSMUST00000173048 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0374_6_F05 DPGS00151_A_B01 Jakmip1tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0374_6_C06 DPGS00151_A_B01 Jakmip1tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0374_6_E05 DPGS00151_A_B01 Jakmip1tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0374_6_G07 DPGS00151_A_B01 Jakmip1tm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 211234 Deletion (Promotor Driven Cassette) PG00151_Y_4_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 211234 Deletion (Promotor Driven Cassette) DPGS00151_A_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 211234 Deletion (Promotor Driven Cassette) PG00151_Y_1_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 211234 Deletion (Promotor Driven Cassette) PG00151_Y_2_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 211234 Deletion (Promotor Driven Cassette) PG00151_Y_3_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
211234 Deletion PCS00151_A_B01