IKMC Project Report - EUCOMM (ID: 40129)

Endov MGI:2444688 ENSMUSG00000039850 OTTMUSG00000003953
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 11 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000106244 protein_coding No protein product (NMD) view

Predicted translation: 

MAHTAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYE
DSRMVGLKAPYVSGFLAFREVPFLVELLRGGLPPWCPYRAAMHRGGQEAPAGGWTGEQCSAQGEDCAPAGRRRHISSDRQ
LWDCPGNGPEEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000798938 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001012357 Endonuclease-V (33/201 aa) CDS CDS
ENSMUSE00000985731 Endonuclease-V (31/201 aa) CDS CDS
ENSMUSE00000985731 Endonuclease-V (15/201 aa) CDS Deleted
ENSMUSE00001056333 Endonuclease-V (14/201 aa) CDS Deleted
ENSMUSE00000979066 Endonuclease-V (38/201 aa) CDS CDS
ENSMUSE00001013146 Endonuclease-V (23/201 aa) CDS CDS
ENSMUSE00001091984 Endonuclease-V (43/201 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085517 Endonuclease-V (6/201 aa) CDS
ENSMUSE00000421567 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000106245 protein_coding No protein product (NMD) view

Predicted translation: 

MVGLKAPYVSGFLAFREVPFLVELLRGGLPPWCPYRAAMHRGGQEAPAGGWTGEQCSAQGEDCAPAGRRRHISSDRQLWD
CPGNGPEEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000794025 UTR UTR
ENSMUSE00001021931 Endonuclease-V (20/157 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021931 Endonuclease-V (15/157 aa) CDS Deleted
ENSMUSE00001056333 Endonuclease-V (14/157 aa) CDS Deleted
ENSMUSE00000979066 Endonuclease-V (38/157 aa) CDS CDS
ENSMUSE00001013146 Endonuclease-V (23/157 aa) CDS CDS
ENSMUSE00001091984 Endonuclease-V (43/157 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085517 Endonuclease-V (6/157 aa) CDS
ENSMUSE00000771010 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000129327 protein_coding No protein product (NMD) view

Predicted translation: 

MVGLKAPYVSGFLAFREVPFLVELLRGGLPPWCPYRAAMHRGGQEAPAGGWTGEQCSAQGEDCAPAGRRRHISSDRQLWD
CPGNGPEEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000882940 UTR UTR
ENSMUSE00001021931 Endonuclease-V (20/157 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021931 Endonuclease-V (15/157 aa) CDS Deleted
ENSMUSE00001056333 Endonuclease-V (14/157 aa) CDS Deleted
ENSMUSE00000979066 Endonuclease-V (38/157 aa) CDS CDS
ENSMUSE00001013146 Endonuclease-V (23/157 aa) CDS CDS
ENSMUSE00001091984 Endonuclease-V (43/157 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085517 Endonuclease-V (6/157 aa) CDS
ENSMUSE00000753975 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000064513 protein_coding No protein product (NMD) view

Predicted translation: 

MVGLKAPYVSGFLAFREVPFLVELLRGGLPPWCPYRAAMHRGGQEAPAGGWTGEQCSAQGEDCAPAGRRRHISSDRQLWD
CPGNGPEEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000896904 Endonuclease-V (20/157 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000896904 Endonuclease-V (15/157 aa) CDS Deleted
ENSMUSE00001056333 Endonuclease-V (14/157 aa) CDS Deleted
ENSMUSE00000979066 Endonuclease-V (38/157 aa) CDS CDS
ENSMUSE00001013146 Endonuclease-V (23/157 aa) CDS CDS
ENSMUSE00001091984 Endonuclease-V (43/157 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085517 Endonuclease-V (6/157 aa) CDS
ENSMUSE00000885415 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000140323 protein_coding No analysis available: incomplete transcript
ENSMUST00000143817 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAHTAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLRSLSWWSCFGVAC
HLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVA
VRLTHHCCRFRIPEPIRQADIRSREYIRRTLGQLGVAPAQRKDRSQKEQRPNACPQGGPGALADQGRPPECDGRDSSSDR
KAPEPGFQEQKDQQLEGTGHQEDSDLWPPSPAWVQSPP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000779755 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000836707 CDS CDS
ENSMUSE00000814570 CDS CDS
ENSMUSE00000814570 CDS Deleted
ENSMUSE00001052834 CDS Deleted
ENSMUSE00001015937 CDS CDS
ENSMUSE00001015079 CDS + stop codon + UTR CDS
ENSMUSE00001067686 UTR CDS
ENSMUSE00000995121 UTR CDS
ENSMUSE00000824462 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153204 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MVGLKAPYVSGFLAFREVPFLVELLRGGLPPWCPYRAAMHRGGQEAPAGGWTGEQCSAQGEDCAPAGRRRHISSDRQLWD
CPGNGPEEP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000832858 UTR UTR
ENSMUSE00001021931 Endonuclease-V (20/30 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021931 Endonuclease-V (11/30 aa) CDS Deleted
ENSMUSE00001015937 CDS CDS
ENSMUSE00001015079 CDS + stop codon + UTR CDS
ENSMUSE00001067686 UTR CDS + stop codon + UTR
ENSMUSE00000995121 UTR UTR
ENSMUSE00000861888 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000154370 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000132015 retained_intron Target region does not overlap transcript
ENSMUST00000143670 retained_intron No analysis available: incomplete transcript
ENSMUST00000134873 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0060_4_B04 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_C04 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_D06 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_D05 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_H06 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_F06 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_C05 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_G05 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_F05 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0060_4_B05 PGS00034_A_D12 Endovtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 158 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00034_A_D12 L1L2_gt0 L3L4_pZero_DTA_kan view
order 158 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00034_A_3_E01 L1L2_gt0 L3L4_pZero_DTA_kan view
order 158 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00034_A_8_E01 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
158 Knockout First, Reporter-tagged insertion with conditional potential PCS00034_A_D12