IKMC Project Report - EUCOMM (ID: 40181)

Prmt1 MGI:107846 ENSMUSG00000052429 OTTMUSG00000020537
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0070_1_B01 C57BL/6Dnk;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/CNB
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -
currently unavailable Genotype confirmed Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0070_1_B02 C57BL/6NTac;C57BL/6NTac;C57BL/6N view
( about ) 		Harwell
Southern Blot pass TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) na
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000107843 protein_coding No protein product (NMD) view

Predicted translation: 

MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000833974 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001034303 CDS CDS
ENSMUSE00001012812 CDS CDS
ENSMUSE00000999953 Ribosomal-L11_MeTrfase_PrmA (28/75 aa) | Arg_MeTrfase (38/254 aa) | Methyltransf_11 (23/99 aa) | Small_mtfrase_dom (28/74 aa) | tRNA_Trfase_Trm5/Tyw2 (28/80 aa) CDS Deleted
ENSMUSE00001068505 Ribosomal-L11_MeTrfase_PrmA (22/75 aa) | Arg_MeTrfase (22/254 aa) | Methyltransf_11 (22/99 aa) | Small_mtfrase_dom (22/74 aa) | tRNA_Trfase_Trm5/Tyw2 (22/80 aa) CDS Deleted
ENSMUSE00001037494 Ribosomal-L11_MeTrfase_PrmA (26/75 aa) | Arg_MeTrfase (48/254 aa) | Methyltransf_11 (48/99 aa) | Small_mtfrase_dom (25/74 aa) | tRNA_Trfase_Trm5/Tyw2 (31/80 aa) CDS CDS + stop codon + UTR
ENSMUSE00001056383 Arg_MeTrfase (30/254 aa) | Methyltransf_11 (7/99 aa) CDS
ENSMUSE00001010575 Arg_MeTrfase (39/254 aa) CDS
ENSMUSE00001077415 Arg_MeTrfase (51/254 aa) CDS
ENSMUSE00001094910 Arg_MeTrfase (29/254 aa) CDS
ENSMUSE00001079624 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000045325 protein_coding No protein product (NMD) view

Predicted translation: 

MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001056495 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001034303 CDS CDS
ENSMUSE00001012812 CDS CDS
ENSMUSE00000999953 Ribosomal-L11_MeTrfase_PrmA (28/75 aa) | Arg_MeTrfase (38/254 aa) | Methyltransf_11 (23/99 aa) | Small_mtfrase_dom (28/74 aa) | tRNA_Trfase_Trm5/Tyw2 (28/80 aa) CDS Deleted
ENSMUSE00001068505 Ribosomal-L11_MeTrfase_PrmA (22/75 aa) | Arg_MeTrfase (22/254 aa) | Methyltransf_11 (22/99 aa) | Small_mtfrase_dom (22/74 aa) | tRNA_Trfase_Trm5/Tyw2 (22/80 aa) CDS Deleted
ENSMUSE00001037494 Ribosomal-L11_MeTrfase_PrmA (26/75 aa) | Arg_MeTrfase (48/254 aa) | Methyltransf_11 (48/99 aa) | Small_mtfrase_dom (25/74 aa) | tRNA_Trfase_Trm5/Tyw2 (31/80 aa) CDS CDS + stop codon + UTR
ENSMUSE00001056383 Arg_MeTrfase (30/254 aa) | Methyltransf_11 (7/99 aa) CDS
ENSMUSE00001010575 Arg_MeTrfase (39/254 aa) CDS
ENSMUSE00001077415 Arg_MeTrfase (51/254 aa) CDS
ENSMUSE00001094910 Arg_MeTrfase (29/254 aa) CDS
ENSMUSE00000674583 CDS
ENSMUSE00000674582 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107842 protein_coding No protein product (NMD) view

Predicted translation: 

MAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000775315 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001012812 CDS CDS
ENSMUSE00000999953 Ribosomal-L11_MeTrfase_PrmA (28/75 aa) | Arg_MeTrfase (38/254 aa) | Methyltransf_11 (23/99 aa) | Small_mtfrase_dom (28/74 aa) | tRNA_Trfase_Trm5/Tyw2 (28/80 aa) CDS Deleted
ENSMUSE00001068505 Ribosomal-L11_MeTrfase_PrmA (22/75 aa) | Arg_MeTrfase (22/254 aa) | Methyltransf_11 (22/99 aa) | Small_mtfrase_dom (22/74 aa) | tRNA_Trfase_Trm5/Tyw2 (22/80 aa) CDS Deleted
ENSMUSE00001037494 Ribosomal-L11_MeTrfase_PrmA (26/75 aa) | Arg_MeTrfase (48/254 aa) | Methyltransf_11 (48/99 aa) | Small_mtfrase_dom (25/74 aa) | tRNA_Trfase_Trm5/Tyw2 (31/80 aa) CDS CDS + stop codon + UTR
ENSMUSE00001056383 Arg_MeTrfase (30/254 aa) | Methyltransf_11 (7/99 aa) CDS
ENSMUSE00001010575 Arg_MeTrfase (39/254 aa) CDS
ENSMUSE00001077415 Arg_MeTrfase (51/254 aa) CDS
ENSMUSE00001094910 Arg_MeTrfase (29/254 aa) CDS
ENSMUSE00000748018 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107840 protein_coding Residual C-terminal product view

Predicted translation: 

MGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPK
QLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYL
TVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001056495 Arg_MeTrfase (3/270 aa) UTR + start codon + CDS
ENSMUSE00000674580 Arg_MeTrfase (51/270 aa) | Ribosomal-L11_MeTrfase_PrmA (28/75 aa) | Methyltransf_11 (23/99 aa) | Small_mtfrase_dom (28/74 aa) | tRNA_Trfase_Trm5/Tyw2 (28/80 aa) CDS Deleted
ENSMUSE00001068505 Arg_MeTrfase (22/270 aa) | Ribosomal-L11_MeTrfase_PrmA (22/75 aa) | Methyltransf_11 (22/99 aa) | Small_mtfrase_dom (22/74 aa) | tRNA_Trfase_Trm5/Tyw2 (22/80 aa) CDS Deleted
ENSMUSE00001037494 Arg_MeTrfase (48/270 aa) | Ribosomal-L11_MeTrfase_PrmA (26/75 aa) | Methyltransf_11 (48/99 aa) | Small_mtfrase_dom (25/74 aa) | tRNA_Trfase_Trm5/Tyw2 (31/80 aa) CDS UTR + start codon + CDS
ENSMUSE00001056383 Arg_MeTrfase (30/270 aa) | Methyltransf_11 (7/99 aa) CDS CDS
ENSMUSE00001010575 Arg_MeTrfase (39/270 aa) CDS CDS
ENSMUSE00001077415 Arg_MeTrfase (51/270 aa) CDS CDS
ENSMUSE00001094910 Arg_MeTrfase (29/270 aa) CDS CDS
ENSMUSE00000518405 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000085387 protein_coding No protein product (NMD) view

Predicted translation: 

MAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001056495 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001012812 CDS CDS
ENSMUSE00000999953 Ribosomal-L11_MeTrfase_PrmA (28/55 aa) | Small_mtfrase_dom (28/59 aa) CDS Deleted
ENSMUSE00001068505 Ribosomal-L11_MeTrfase_PrmA (22/55 aa) | Small_mtfrase_dom (22/59 aa) CDS Deleted
ENSMUSE00000532179 Ribosomal-L11_MeTrfase_PrmA (6/55 aa) | Small_mtfrase_dom (10/59 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077415 CDS
ENSMUSE00001094910 CDS
ENSMUSE00001079624 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153576 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MAAAEAANCIMENFVATLANGMSLQPPLEEVTLLPCPSMCLPWLCPLSLPPQLWAELETGHRAWRDGRRGGCSLDGALGF
LWPSRK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001056495 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001091545 CDS CDS
ENSMUSE00000982918 CDS CDS
ENSMUSE00001049255 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001066181 UTR Deleted
ENSMUSE00001077366 UTR Deleted
ENSMUSE00001058393 UTR UTR
ENSMUSE00000977925 UTR UTR
ENSMUSE00001055457 UTR UTR
ENSMUSE00001068735 UTR UTR
ENSMUSE00001073936 UTR UTR
ENSMUSE00000969761 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000125886 processed_transcript No analysis available: incomplete transcript
ENSMUST00000127531 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0070_1_B01 PGS00046_A_B02 Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR pass
order EPD0070_1_B02 PGS00046_A_B02 Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0070_1_G01 PGS00046_A_B02 Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0070_1_C03 PGS00046_A_B02 Prmt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly fail
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 43070 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00046_A_B02 L1L2_gt0 L3L4_pZero_DTA_kan view
order 43070 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00046_A_4_B02 L1L2_gt0 L3L4_pZero_DTA_kan view
order 43070 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00046_A_1_B02 L1L2_gt0 L3L4_pZero_DTA_kan view
order 43070 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00046_A_2_B02 L1L2_gt0 L3L4_pZero_DTA_kan view
order 43070 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00046_A_3_B02 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
43070 Knockout First, Reporter-tagged insertion with conditional potential PCS00046_A_B02