IKMC Project Report - EUCOMM (ID: 40266)

Ren1 MGI:97898 ENSMUSG00000070645 OTTMUSG00000021617
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000094556 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MDRRRMPLWALLLLWSPCTFSLPTRTATFERGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLL
CEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKL
CTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000596636 Propep_A1 (1/25 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000596635 Propep_A1 (25/25 aa) CDS Deleted
ENSMUSE00000596634 Peptidase_A1 (40/318 aa) CDS Deleted
ENSMUSE00000596633 Peptidase_A1 (40/318 aa) CDS Deleted
ENSMUSE00000596632 Peptidase_A1 (66/318 aa) CDS Deleted
ENSMUSE00000596631 Peptidase_A1 (41/318 aa) CDS CDS
ENSMUSE00000596630 Peptidase_A1 (49/318 aa) CDS CDS
ENSMUSE00000596629 Peptidase_A1 (33/318 aa) CDS CDS
ENSMUSE00000596628 Peptidase_A1 (52/318 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112287 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available