IKMC Project Report - EUCOMM (ID: 40361)

Brpf3 MGI:2146836 ENSMUSG00000063952 OTTMUSG00000017315
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000004985 protein_coding No protein product (NMD) view

Predicted translation:

MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKIITEDELTAQDITECNSNKEN
SEQPQFPAKSKKPSSKGKRKESCSKHASGTSFHLPQPSFRVVDTGSQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEED
IAWLDMVNEKRRADGHSSVSADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVCFANTVFLEPIEGIDNIPPAR
WKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFMKIEPMRETSLNGTTFTVRKTAYCEAHSPSVAVARRKGDSP
RSLSEVGDEDGPKEGGGEEEQEEAEEEGQEGQGGVGSPLKGVSKKGKMSLKQKIKKEPEEAGREAPSITLPMVTVPQIPS
YRLNKICSGLSFQRKTQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDEKTSAVKEELKYWQKLRHDLER
ARLLIELIRKREKLKREQVKVQQAAMELELMPFTVLLRTTLDLLQEKDSAHIFAEPVSLSEVPDYLEFISKPMDFSTMRR
KLESHLYHTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPRLEDFYR
FSWEDVDNILIPENRAHLSPEAQLKELLEKLDLVSTMRSSGARTRRVRMLRREINALRQKLAQPPPPQLLSLNKTVPNGE
LPAGSRGDTAVLEQAQQEEPEEEGDRDDSKLPAPPTLEPTGPAPSLSEQESPPDPPTLKPISDSKPSSRFLKSRKVEDEE
LLEKSALQLGSEPLQCLLSDNGIDRLSLTNPDSHPDTPLGTVGRRTSVLFKKAKNGVKLQRGPDGTLENGEDHGPEDDPA
SPASTEDEHYSRKRPRSRSCSDSEGERSPQQEEETVA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000700433 UTR UTR
ENSMUSE00000700432 Enhancer_polycomb-like_N (147/147 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000965360 CDS CDS
ENSMUSE00001060976 CDS CDS
ENSMUSE00001032301 Bromodomain (21/79 aa) CDS CDS
ENSMUSE00000994881 Bromodomain (58/79 aa) CDS CDS
ENSMUSE00001061502 CDS CDS
ENSMUSE00001032572 CDS CDS
ENSMUSE00001067735 CDS Deleted
ENSMUSE00001037339 CDS CDS + stop codon + UTR
ENSMUSE00000971919 PWWP (18/88 aa) CDS
ENSMUSE00000994997 PWWP (52/88 aa) CDS
ENSMUSE00000733470 PWWP (19/88 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000156029 retained_intron No analysis available: incomplete transcript
ENSMUST00000140973 processed_transcript No analysis available: incomplete transcript
ENSMUST00000127007 processed_transcript Target region does not overlap transcript
ENSMUST00000140587 processed_transcript No analysis available: incomplete transcript
ENSMUST00000144022 processed_transcript No analysis available: incomplete transcript
ENSMUST00000126868 processed_transcript Target region does not overlap transcript
ENSMUST00000148149 retained_intron Target region does not overlap transcript
ENSMUST00000136233 processed_transcript Target region does not overlap transcript
ENSMUST00000123942 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available