IKMC Project Report - EUCOMM (ID: 40457)

Angel2 MGI:1196310 ENSMUSG00000026634 OTTMUSG00000021514
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000066632 protein_coding No protein product (NMD) view

Predicted translation: 

METWRCVRRGYGRCVAGRGRYSMFPYPLKSLGRDWTTPWEDLQKYCWRRHISSCLRWPGHYSRAPYPYFSSRHFSLNCRP
PFLFESGTQFQYYNWRSDHLSNASLIHLSRHVMTSDRDEPLSKRRKHQGALSTGSSRRSLWDRNQAKSGITGLSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001073402 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001006711 CDS CDS
ENSMUSE00000984195 Endo/exonuclease/phosphatase (47/374 aa) CDS Deleted
ENSMUSE00000986250 Endo/exonuclease/phosphatase (24/374 aa) CDS CDS
ENSMUSE00000533865 Endo/exonuclease/phosphatase (141/374 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077083 Endo/exonuclease/phosphatase (43/374 aa) CDS
ENSMUSE00001073585 Endo/exonuclease/phosphatase (20/374 aa) CDS
ENSMUSE00001053629 Endo/exonuclease/phosphatase (56/374 aa) CDS
ENSMUSE00000964566 Endo/exonuclease/phosphatase (47/374 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000110899 protein_coding No protein product (NMD) view

Predicted translation: 

MFPYPLKSLGRDWTTPWEDLQKYCWRRHISSCLRWPGHYSRAPYPYFSSRHFSLNCRPPFLFESGTQFQYYNWRSDHLSN
ASLIHLSRHVMTSDRDEPLSKRRKHQGALSTGSSRRSLWDRNQAKSGITGLSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000685825 UTR UTR
ENSMUSE00001039476 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000984195 Endo/exonuclease/phosphatase (47/374 aa) CDS Deleted
ENSMUSE00000986250 Endo/exonuclease/phosphatase (24/374 aa) CDS CDS
ENSMUSE00000533865 Endo/exonuclease/phosphatase (141/374 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077083 Endo/exonuclease/phosphatase (43/374 aa) CDS
ENSMUSE00001073585 Endo/exonuclease/phosphatase (20/374 aa) CDS
ENSMUSE00001053629 Endo/exonuclease/phosphatase (56/374 aa) CDS
ENSMUSE00000964566 Endo/exonuclease/phosphatase (47/374 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000027947 protein_coding No protein product (NMD) view

Predicted translation: 

MFPYPLKSLGRDWTTPWEDLQKYCWRRHISSCLRWPGHYSRAPYPYFSSRHFSLNCRPPFLFESGTQFQYYNWRSDHLSN
ASLIHLSRHVMTSDRDEPLSKRRKHQGALSTGSSRRSLWDRNQAKSGITGLSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000685838 UTR UTR
ENSMUSE00000685837 UTR UTR
ENSMUSE00001039476 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000984195 Endo/exonuclease/phosphatase (47/374 aa) CDS Deleted
ENSMUSE00000986250 Endo/exonuclease/phosphatase (24/374 aa) CDS CDS
ENSMUSE00000533865 Endo/exonuclease/phosphatase (141/374 aa) CDS CDS + stop codon + UTR
ENSMUSE00001077083 Endo/exonuclease/phosphatase (43/374 aa) CDS
ENSMUSE00001073585 Endo/exonuclease/phosphatase (20/374 aa) CDS
ENSMUSE00001053629 Endo/exonuclease/phosphatase (56/374 aa) CDS
ENSMUSE00000964566 Endo/exonuclease/phosphatase (47/374 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135364 protein_coding No analysis available: incomplete transcript
ENSMUST00000123384 nonsense_mediated_decay Residual C-terminal product view

Predicted translation: 

MKTGRKPDGCAICFKHSRFSLLSVNPVEFCRRDIPLLDRDNIGLVLLLQPKIPRAASPSICIANTHLLYNPRRGDIKLTQ
LAMLLAEIANVTHRKDGSSCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLAIGKTVM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001059496 UTR UTR
ENSMUSE00000977514 Endo/exonuclease/phosphatase (44/205 aa) UTR + start codon + CDS Deleted
ENSMUSE00000986250 Endo/exonuclease/phosphatase (24/205 aa) CDS
ENSMUSE00000533865 Endo/exonuclease/phosphatase (138/205 aa) CDS UTR + start codon + CDS
ENSMUSE00001070852 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001090156 UTR UTR
ENSMUSE00001063206 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000144693 retained_intron No analysis available: incomplete transcript
ENSMUST00000137608 retained_intron No analysis available: incomplete transcript
ENSMUST00000134187 retained_intron No analysis available: incomplete transcript
ENSMUST00000130298 processed_transcript Target region does not overlap transcript
ENSMUST00000146048 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0431_1_F03 PG00073_Z_7_B07 Angel2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_B01 PG00073_Z_7_B07 Angel2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_D04 PG00073_Z_7_B07 Angel2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0175_4_F08 PRPGS00073_A_B07 Angel2tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0175_4_C08 PRPGS00073_A_B07 Angel2tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0175_4_F07 PRPGS00073_A_B07 Angel2tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_H04 PG00073_Z_7_B07 Angel2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0175_4_A08 PRPGS00073_A_B07 Angel2tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_F02 PG00073_Z_7_B07 Angel2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_D02 PG00073_Z_7_B07 Angel2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0431_1_E03 PG00073_Z_7_B07 Angel2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_8_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_5_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_2_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_6_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_3_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_4_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_1_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00073_A_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00073_Z_7_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
49396 Knockout-First - Reporter Tagged Insertion PCS00073_A_B07