IKMC Project Report - KOMP-CSD (ID: 40572)

Rgs18 MGI:1927498 ENSMUSG00000026357 OTTMUSG00000026870
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027603 protein_coding No protein product (NMD) view

Predicted translation: 

MDMSLVFFSQLNMCESKEKTFFKLMHGSGKEETSIEAKIRAKEKRNRLSLLLQRPDFHGETQASRSALLAKETRWSGCFY
QIS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000403380 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000158367 CDS CDS
ENSMUSE00000158371 Regulat_G_prot_signal (9/115 aa) CDS Deleted
ENSMUSE00000158370 Regulat_G_prot_signal (56/115 aa) CDS CDS + stop codon + UTR
ENSMUSE00000390094 Regulat_G_prot_signal (51/115 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0653_5_C09 PG00055_Z_4_D06 Rgs18tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PGRDS0001_A_C04 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_4_D05 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_3_D06 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00055_A_D06 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PGRDS0001_A_C03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_1_D06 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_2_D06 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_2_D05 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45211 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00055_Z_4_D06 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45211 Knockout-First - Reporter Tagged Insertion PCS00055_A_D06