IKMC Project Report - EUCOMM (ID: 40738)

Emp1 MGI:107941 ENSMUSG00000030208 OTTMUSG00000021171
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000111907 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MLVLLAGLFVVHIATAIMLFVSTIANGCVSWLECQSTLIITPTAKGTSTPAATKAIVSS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000689717 UTR UTR
ENSMUSE00001053431 PMP22/EMP/MP20/Claudin (25/154 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010754 PMP22/EMP/MP20/Claudin (33/154 aa) CDS Deleted
ENSMUSE00000975549 PMP22/EMP/MP20/Claudin (48/154 aa) CDS Deleted
ENSMUSE00001022502 PMP22/EMP/MP20/Claudin (50/154 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000032330 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MLVLLAGLFVVHIATAIMLFVSTIANGCVSWLECQSTLIITPTAKGTSTPAATKAIVSS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000382479 UTR UTR
ENSMUSE00001053431 PMP22/EMP/MP20/Claudin (25/154 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010754 PMP22/EMP/MP20/Claudin (33/154 aa) CDS Deleted
ENSMUSE00000975549 PMP22/EMP/MP20/Claudin (48/154 aa) CDS Deleted
ENSMUSE00001022502 PMP22/EMP/MP20/Claudin (50/154 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000154270 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available