IKMC Project Report - EUCOMM (ID: 41361)

1200014J11Rik MGI:1914124 ENSMUSG00000020783 OTTMUSG00000006118
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021135 protein_coding No protein product (NMD) view

Predicted translation:

MAAVRGLRVSVKAEAPAGPALGLPSPEVESGLERGEPEPMEVEEGELEIVPVRRSLKELLPDTSRRYENKAGSFITGIDV
TSKQFPR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000809162 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021003 CDS CDS
ENSMUSE00001079337 CDS Deleted
ENSMUSE00000109249 DUF2414 (39/57 aa) CDS CDS + stop codon + UTR
ENSMUSE00000109248 DUF2414 (19/57 aa) CDS
ENSMUSE00000109251 CDS
ENSMUSE00000311071 CDS
ENSMUSE00000311058 CDS
ENSMUSE00000109231 CDS
ENSMUSE00000109217 CDS
ENSMUSE00000109229 CDS
ENSMUSE00000311020 CDS
ENSMUSE00000311013 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000151823 retained_intron No analysis available: incomplete transcript
ENSMUST00000144262 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 331 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00007_A_G01 L1L2_gt0 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
331 Knockout-First - Reporter Tagged Insertion PCS00007_A_G01