IKMC Project Report - KOMP-CSD (ID: 41697)

Spink12 MGI:1925492 ENSMUSG00000061144 OTTMUSG00000028110
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000081271 protein_coding No protein product (NMD) view

Predicted translation: 

MFNAPNISVFSDLKILSAMKPAGAFLLLISLACLFLSVGFLQQL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000142644 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000142646 CDS Deleted
ENSMUSE00000142640 Prot_inh_Kazal (40/56 aa) | Kazal-type_dom (26/42 aa) CDS CDS + stop codon + UTR
ENSMUSE00000659440 Prot_inh_Kazal (16/56 aa) | Kazal-type_dom (16/42 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0673_2_H09 PG00059_Z_1_E06 Spink12tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0673_2_D11 PG00059_Z_1_E06 Spink12tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46074 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00059_A_E12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46074 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00059_Z_4_E12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46074 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGRDS0001_A_F12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46074 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00059_Z_3_E12 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46074 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00059_Z_1_E06 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46074 Knockout First, Reporter-tagged insertion with conditional potential PCS00059_A_E12