IKMC Project Report - KOMP-CSD (ID: 41697)
Spink12 MGI:1925492 ENSMUSG00000061144 OTTMUSG00000028110
Mice no data available
Mutagenesis Predictions
This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000081271 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||
|
Predicted translation: MFNAPNISVFSDLKILSAMKPAGAFLLLISLACLFLSVGFLQQL*
|
||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0673_2_H09 | PG00059_Z_1_E06 | Spink12tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0673_2_D11 | PG00059_Z_1_E06 | Spink12tm1a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 46074 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00059_A_E12 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
| order | 46074 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00059_Z_4_E12 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
| order | 46074 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PGRDS0001_A_F12 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
| order | 46074 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00059_Z_3_E12 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
| order | 46074 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00059_Z_1_E06 | L1L2_Bact_P | L4L3_pD223_DTA_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 46074 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00059_A_E12 |