IKMC Project Report - KOMP-CSD (ID: 42024)

Cldn16 MGI:2148742 ENSMUSG00000038148 OTTMUSG00000028402
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Cldn16tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0150_2_B12 C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000161053 protein_coding No protein product (NMD) view

Predicted translation: 

MKDLLQYAACFLAIFSTGFLIVATWTDCWMVNADDSLE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000861950 PMP22/EMP/MP20/Claudin (28/174 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000267396 PMP22/EMP/MP20/Claudin (35/174 aa) CDS Deleted
ENSMUSE00000267391 PMP22/EMP/MP20/Claudin (56/174 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267384 PMP22/EMP/MP20/Claudin (57/174 aa) CDS
ENSMUSE00000855358 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115302 protein_coding No protein product (NMD) view

Predicted translation: 

MKDLLQYAACFLAIFSTGFLIVATWTDCWMVNADDSLE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000702393 UTR UTR
ENSMUSE00000702392 PMP22/EMP/MP20/Claudin (28/174 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000267396 PMP22/EMP/MP20/Claudin (35/174 aa) CDS Deleted
ENSMUSE00000267391 PMP22/EMP/MP20/Claudin (56/174 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267384 PMP22/EMP/MP20/Claudin (57/174 aa) CDS
ENSMUSE00000702391 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0150_2_B12 PRPGS00061_B_B11 Cldn16tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00537_3_D07 PG00061_Y_3_B11 Cldn16tm1a(KOMP)Mbp Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00537_3_G05 PG00061_Y_3_B11 Cldn16tm1a(KOMP)Mbp Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00537_3_G07 PG00061_Y_3_B11 Cldn16tm1a(KOMP)Mbp Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00537_3_G08 PG00061_Y_3_B11 Cldn16tm1a(KOMP)Mbp Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0150_2_F11 PRPGS00061_B_B11 Cldn16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Y_3_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Y_1_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Z_4_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Y_5_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Y_7_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00061_Y_6_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00061_A_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 46517 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00061_B_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46517 Knockout-First - Reporter Tagged Insertion PCS00061_A_B11