IKMC Project Report - NorCOMM (ID: 42254)

Dek MGI:1926209 ENSMUSG00000021377 OTTMUSG00000024779
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021807 protein_coding No protein product (NMD) view

Predicted translation: 

MSAAAAPAAEGEDAPVPPSSEKEPEMPGPREESEEEEEDDEDDDEEDEEEEKGVLVEEERGSVQWLSIRKRQYPV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000762655 UTR UTR
ENSMUSE00000999416 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001095094 CDS Deleted
ENSMUSE00000117456 CDS Deleted
ENSMUSE00000117453 SAP_DNA-bd (2/35 aa) CDS CDS + stop codon + UTR
ENSMUSE00000117451 SAP_DNA-bd (34/35 aa) CDS
ENSMUSE00001066365 CDS
ENSMUSE00001003556 CDS
ENSMUSE00001004246 DEK_C (28/55 aa) CDS
ENSMUSE00000997463 DEK_C (23/55 aa) CDS
ENSMUSE00000762084 DEK_C (3/55 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000129352 protein_coding No analysis available: incomplete transcript
ENSMUST00000135278 protein_coding No analysis available: incomplete transcript
ENSMUST00000138401 processed_transcript Target region does not overlap transcript
ENSMUST00000143933 processed_transcript No analysis available: incomplete transcript
ENSMUST00000150652 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00932P1_C_122W_C11 N00932P1_T_132.123_G07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00932P1_C_122W_C8 N00932P1_T_132.123_G07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00932P1_C_122W_C9 N00932P1_T_132.123_G07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00932P1_C_122W_F9 N00932P1_T_132.123_G07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00932P1_C_122W_G8 N00932P1_T_132.123_G07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 199335 Deletion (Promotor Driven Cassette) N00932P1_T_132.123_G07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
199335 Deletion N00932P1_I_132.123_G07