IKMC Project Report - NorCOMM (ID: 42288)

Ybx1 MGI:99146 ENSMUSG00000028639 OTTMUSG00000009259
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000079644 protein_coding No protein product (NMD) view

Predicted translation: 

MSSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRLP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000781541 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001006811 CSP_DNA-bd (18/69 aa) CDS CDS
ENSMUSE00001079823 CSP_DNA-bd (12/69 aa) CDS Deleted
ENSMUSE00000525213 CSP_DNA-bd (30/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00000483303 CSP_DNA-bd (10/69 aa) CDS
ENSMUSE00000497376 CDS
ENSMUSE00000498460 CDS + stop codon + UTR
ENSMUSE00000839196 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000127737 protein_coding Target region does not overlap transcript
ENSMUST00000145976 processed_transcript Target region does not overlap transcript
ENSMUST00000139897 processed_transcript No analysis available: incomplete transcript
ENSMUST00000144992 processed_transcript Target region does not overlap transcript
ENSMUST00000142884 processed_transcript No analysis available: incomplete transcript
ENSMUST00000152733 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00148P0_C_40W_A10 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_B10 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_B9 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_C10 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_D10 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_F9 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_G9 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00148P0_C_40W_H9 N00148P0_T_124.7_F09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46639 Deletion (Promotorless Cassette) N00148P0_T_124.7_F09 L1L2_NTARU-2 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46639 Deletion N00148P0_I_124.7_F09