IKMC Project Report - NorCOMM (ID: 42335)

Slirp MGI:1916394 ENSMUSG00000021040 OTTMUSG00000033355
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000161023 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAASAIKGLSALRSSTGRPIAFVRKIPWTAAARQRDWLSQRHGLGSVFLSGRTSECTTTRTSYY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856653 RRM_dom (11/68 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000114109 RRM_dom (20/68 aa) CDS Deleted
ENSMUSE00000505230 RRM_dom (36/68 aa) CDS CDS + stop codon + UTR
ENSMUSE00000862312 RRM_dom (2/68 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160488 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAASAIKGLSALRSSTGRPIAFVRKIPWTAAARQRDWLSQRHGLGSVFLSGRTSECTTTRTSYY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000114107 RRM_dom (11/64 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000114109 RRM_dom (20/64 aa) CDS Deleted
ENSMUSE00000872077 RRM_dom (34/64 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000077462 protein_coding No analysis available: incomplete transcript
ENSMUST00000160880 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01554P0_C_26T_A3 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_26T_B3 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_26T_D3 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_26T_E3 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_26T_F3 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_B1 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_B2 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_D2 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_E1 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_F1 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_F2 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_G1 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_G2 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_H1 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N01554P0_C_35T_H2 N01554P0_T_152.1_D07 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 212400 Deletion (Promotorless Cassette) N01554P0_T_152.1_D07 L1L2_NTARU-1 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
212400 Deletion N01554P0_I_152.1_D07