IKMC Project Report - NorCOMM (ID: 42474)

Mcm10 MGI:1917274 ENSMUSG00000026669 OTTMUSG00000010867
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027980 protein_coding No protein product (NMD) view

Predicted translation: 

MDVEEDDLCLLTSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGD
VEDLTDDEVATSKVGNSGPPPAPSQEKTSEELQDELKKLQEQMKSLQEQLKAASIKQPPGTAPLQEPPDSSLQPLLKEKR
IRRIQESACFSAELDVPTLPKAKRVARKPKTPAGDLESPPQK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701397 UTR UTR
ENSMUSE00001085812 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010705 CDS CDS
ENSMUSE00001054877 CDS CDS
ENSMUSE00000983198 CDS CDS
ENSMUSE00000431015 CDS Deleted
ENSMUSE00000335197 CDS CDS + stop codon + UTR
ENSMUSE00001036824 CDS
ENSMUSE00000984969 Znf_Mcm10/DnaG (24/46 aa) CDS
ENSMUSE00001040901 Znf_Mcm10/DnaG (22/46 aa) CDS
ENSMUSE00001019885 CDS
ENSMUSE00001022344 Rep_factor_Mcm10 (21/346 aa) CDS
ENSMUSE00001090884 Rep_factor_Mcm10 (37/346 aa) CDS
ENSMUSE00001010858 Rep_factor_Mcm10 (77/346 aa) CDS
ENSMUSE00001008282 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001049064 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00000970635 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00001025783 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001016474 Rep_factor_Mcm10 (15/346 aa) CDS
ENSMUSE00001036483 Rep_factor_Mcm10 (26/346 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000102985 protein_coding No protein product (NMD) view

Predicted translation: 

MDVEEDDLCLLTSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGD
VEDLTDDEVATSKVGNSGPPPAPSQEKTSEELQDELKKLQEQMKSLQEQLKAASIKQPPGTAPLQEPPDSSLQPLLKEKR
IRRIQESACFSAELDVPTLPKAKRVARKPKTPAGDLESPPQK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000660938 UTR UTR
ENSMUSE00001085812 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010705 CDS CDS
ENSMUSE00001054877 CDS CDS
ENSMUSE00000983198 CDS CDS
ENSMUSE00000431015 CDS Deleted
ENSMUSE00000335197 CDS CDS + stop codon + UTR
ENSMUSE00001036824 CDS
ENSMUSE00000984969 Znf_Mcm10/DnaG (24/46 aa) CDS
ENSMUSE00001040901 Znf_Mcm10/DnaG (22/46 aa) CDS
ENSMUSE00001019885 CDS
ENSMUSE00001022344 Rep_factor_Mcm10 (21/346 aa) CDS
ENSMUSE00001090884 Rep_factor_Mcm10 (37/346 aa) CDS
ENSMUSE00001010858 Rep_factor_Mcm10 (77/346 aa) CDS
ENSMUSE00001008282 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001049064 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00000970635 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00001025783 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001016474 Rep_factor_Mcm10 (15/346 aa) CDS
ENSMUSE00000660935 Rep_factor_Mcm10 (26/346 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125201 retained_intron Target region does not overlap transcript
ENSMUST00000150091 retained_intron Target region does not overlap transcript
ENSMUST00000125349 retained_intron Target region does not overlap transcript
ENSMUST00000139882 retained_intron Target region does not overlap transcript
ENSMUST00000125851 retained_intron Target region does not overlap transcript
ENSMUST00000151533 retained_intron Target region does not overlap transcript
ENSMUST00000129443 processed_transcript No analysis available: incomplete transcript
ENSMUST00000146257 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00006P0_C_6T_A5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_B5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_C5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_D5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_E5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_F5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_G5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00006P0_C_6T_H5 N00006P0_T_1-67.1_M6 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 301345 Deletion (Promotorless Cassette) N00006P0_T_1-67.1_M6 L1L2_NTARU-1 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
301345 Deletion N00006P0_I_1-67.1_M6