IKMC Project Report - NorCOMM (ID: 42537)

Gna13 MGI:95768 ENSMUSG00000020611 OTTMUSG00000003357
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000020930 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRA
REEFRPTIYSNVIKG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000413421 Gprotein_alpha_su (72/354 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000233786 Gprotein_alpha_su (76/354 aa) CDS Deleted
ENSMUSE00000233781 Gprotein_alpha_su (17/354 aa) CDS CDS + stop codon + UTR
ENSMUSE00000646624 Gprotein_alpha_su (190/354 aa) | Small_GTPase_ARF/SAR (102/102 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000106702 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRA
REEFRPTIYSNVIKDGDLT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000413421 Gprotein_alpha_su (72/150 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000233786 Gprotein_alpha_su (76/150 aa) CDS Deleted
ENSMUSE00000670910 Gprotein_alpha_su (3/150 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00091P0_C_46W_A5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00091P0_C_46W_B5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00091P0_C_46W_C5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00091P0_C_46W_E5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00091P0_C_46W_F5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00091P0_C_46W_H5 N00091P0_T_152.1_B01 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46580 Deletion (Promotorless Cassette) N00091P0_T_152.1_B01 L1L2_NTARU-1 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46580 Deletion N00091P0_I_152.1_B01