IKMC Project Report - NorCOMM (ID: 42565)

Ammecr1 MGI:1860206 ENSMUSG00000042225 OTTMUSG00000018861
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000041317 protein_coding No protein product (NMD) view

Predicted translation: 

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLSGGGGSGGGGGCPLSPPQGCG
GGGGGGGGGGSGSGGGGISLSPPLSCGVGTLLSTPAAATASSPSSSSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPR
TPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTRWVCMALE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000377398 AMMECR1_domain (27/172 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000255152 AMMECR1_domain (38/172 aa) CDS CDS
ENSMUSE00000545018 AMMECR1_domain (39/172 aa) CDS Deleted
ENSMUSE00000545017 AMMECR1_domain (31/172 aa) CDS CDS + stop codon + UTR
ENSMUSE00000255129 AMMECR1_domain (33/172 aa) CDS
ENSMUSE00000374794 AMMECR1_domain (8/172 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02186P1_C_213W_A1 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_B4 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_C1 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_C2 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_F1 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_F2 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02186P1_C_213W_H1 N02186P1_T_192.4_C01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 254032 Deletion (Promotor Driven Cassette) N02186P1_T_192.4_C01 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
254032 Deletion N02186P1_I_192.4_C01