IKMC Project Report - NorCOMM (ID: 42578)

Ckmt2 MGI:1923972 ENSMUSG00000021622 OTTMUSG00000029571
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022122 protein_coding No protein product (NMD) view

Predicted translation: 

MASAFSKLLTGRNASLLFTTLGTSALTTGYLLNRQKVSADAREQHKLFPPRYLLTFLILSSN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000482717 UTR UTR
ENSMUSE00000119504 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000228202 ATP-guanido_PTrfase_N (62/80 aa) CDS Deleted
ENSMUSE00000119508 ATP-guanido_PTrfase_N (18/80 aa) CDS CDS + stop codon + UTR
ENSMUSE00000119505 ATP-guanido_PTrfase_cat (68/247 aa) CDS
ENSMUSE00000119506 ATP-guanido_PTrfase_cat (29/247 aa) CDS
ENSMUSE00000119507 ATP-guanido_PTrfase_cat (42/247 aa) CDS
ENSMUSE00000119509 ATP-guanido_PTrfase_cat (45/247 aa) CDS
ENSMUSE00000228157 ATP-guanido_PTrfase_cat (42/247 aa) CDS
ENSMUSE00000410389 ATP-guanido_PTrfase_cat (22/247 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00048P1_C_260W_A3 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_B2 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_B3 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_C2 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_D2 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_E1 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_G2 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N00048P1_C_260W_H1 N00048P1_T_1-67.2_E02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 89575 Deletion (Promotor Driven Cassette) N00048P1_T_1-67.2_E02 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
89575 Deletion N00048P1_I_1-67.2_E02